1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. TL1A
  6. TL1A/TNFSF15 Protein, Mouse

The TL1A protein (VEGI protein), belongs to the tumor necrosis factor (TNF) family and is a receptor for TNFRSF25 and TNFRSF6B. TL1A is involved in the activation of NF-κB and C-Jun pathways, which can be used as a regulator of mucosal immunity and participate in the immune pathway of inflammatory bowel disease (IBD) pathogenesis. TL1A originates from endothelial cells and inhibits the proliferation of breast cancer, epithelial and myeloid tumor cells. The mouse TL1A protein has a transmembrane domain (40-60 a.a.) that can be cleaved into membrane-type and soluble peptide fragments. TL1A/TNFSF15 Protein, Mouse is the extracullar part of TL1A protein (I76-L252), produced in E.coli with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

TL1A/TNFSF15 Protein, Mouse Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

The TL1A protein (VEGI protein), belongs to the tumor necrosis factor (TNF) family and is a receptor for TNFRSF25 and TNFRSF6B. TL1A is involved in the activation of NF-κB and C-Jun pathways, which can be used as a regulator of mucosal immunity and participate in the immune pathway of inflammatory bowel disease (IBD) pathogenesis[1][2]. TL1A originates from endothelial cells and inhibits the proliferation of breast cancer, epithelial and myeloid tumor cells[3]. The mouse TL1A protein has a transmembrane domain (40-60 a.a.) that can be cleaved into membrane-type and soluble peptide fragments. TL1A/TNFSF15 Protein, Mouse is the extracullar part of TL1A protein (I76-L252), produced in E.coli with tag free.

Background

TL1A (Tumor necrosis factor-like cytokine 1A), also known as TNF ligand-related molecule 1 and vascular endothelial cell growth inhibitor (VEGI), is the receptor for TNFRSF25 and TNFRSF6B, acts as a regulator of mucosal immunity and participates in immunological pathways involved in the inflammatory bowel diseases (IBD) pathogenesis[1]. TL1A belongs to the tumor necrosis factor family, derived from endothelial cell. It is a ligand for DR3 and decoy receptor TR6/DcR3, the interaction with DR3 promotes T cell expansion during an immune response, whereas TR6 has an opposing effect. Moreover, DR3 is the death domain-containing receptor, that is upregulated during T cell activation. TL1A shows an inducible expression by TNF and IL-1alpha, and induces NF-kappaB activation and apoptosis in DR3-expressing cell lines. Meanwhile, TL1A acts as a costimulator that increases IL-2 responsiveness and secretion of proinflammatory cytokines[2]. In addition, TL1A activates c-Jun N-terminal kinase. TL1A also activates caspase-3 leading to PARP cleavage, and inhibits the proliferation of breast carcinoma, epithelial, and myeloid tumor cells. TL1A promotes proliferation of normal human fibroblast cells. These results suggest that VEGI, a new member of the TNF family, has a signaling pathway similar to TNF and is most likely a multifunctional cytokine[3]. Mouse TL1A protein has two glycosylated domains and one transmembrane domain (36-56 a.a.), and can be cleaved into membrane-type peptide fragments and soluble peptide fragments. The protein sequence of mouse is much different from rat and human with similarities of 85.32% and 68.42%, respectively.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

B2RR33/AAV33431.1 (I76-L252)

Gene ID
Molecular Construction
N-term
TL1A (I76-L252)
Accession # B2RR33/AAV33431.1
C-term
Synonyms
Tumor Necrosis Factor Ligand Superfamily Member 15; TNF Ligand-Related Molecule 1; Vascular Endothelial Cell Growth Inhibitor; TNFSF15; TL1; VEGI
AA Sequence

ITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

Molecular Weight

22 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 300 mM NaCl, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TL1A/TNFSF15 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TL1A/TNFSF15 Protein, Mouse
Cat. No.:
HY-P72446
Quantity:
MCE Japan Authorized Agent: