1. Recombinant Proteins
  2. Others
  3. TLE3 Protein, Human (GST)

The TLE3 protein is a transcriptional corepressor that inhibits Wnt signaling by binding to transcription factors such as CTNNB1 and TCF family members. It forms homotetramers, hetero-oligomers, and interacts with AES. TLE3 Protein, Human (GST) is the recombinant human-derived TLE3 protein, expressed by E. coli , with N-GST labeled tag. The total length of TLE3 Protein, Human (GST) is 289 a.a., with molecular weight of ~58.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TLE3 protein is a transcriptional corepressor that inhibits Wnt signaling by binding to transcription factors such as CTNNB1 and TCF family members. It forms homotetramers, hetero-oligomers, and interacts with AES. TLE3 Protein, Human (GST) is the recombinant human-derived TLE3 protein, expressed by E. coli , with N-GST labeled tag. The total length of TLE3 Protein, Human (GST) is 289 a.a., with molecular weight of ~58.5 kDa.

Background

TLE3, a transcriptional corepressor, intricately regulates gene expression by binding to various transcription factors and exerting inhibitory effects on transcriptional activation mediated by CTNNB1 and TCF family members in the Wnt signaling pathway. TLE3 forms homotetramers and heterooligomers with other family members, and its regulatory influence may be modulated by its association with the dominant-negative factor AES. Among its molecular interactions, TLE3 binds to LEF1, TCF7, and TCF7L1, establishing its involvement in modulating the transcriptional activities of these crucial factors. Additionally, TLE3 engages in protein-protein interactions with FOXA2, XIAP/BIRC4, and TCF7L2/TCF4. Notably, its interaction with TBX18, involving the engrailed homology 1 repressor motif, leads to a reduction in TBX18's transcriptional activity, underscoring TLE3's role in finely tuning specific transcriptional responses.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q04726 (S484-Y772)

Gene ID
Molecular Construction
N-term
GST
TLE3 (S484-Y772)
Accession # Q04726
C-term
Synonyms
Transducin-like enhancer protein 3; ESG3; TLE3; KIAA1547
AA Sequence

SHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY

Molecular Weight

Approximately 32 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCL, 150 mM NaCl, 5 mM GSH, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TLE3 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TLE3 Protein, Human (GST)
Cat. No.:
HY-P76675
Quantity:
MCE Japan Authorized Agent: