TM2D1 Protein, Human (HEK293, Fc)

The TM2D1 protein may be involved in amyloid beta-induced apoptosis by interacting with beta-APP42, especially amyloid beta protein 42 (APP beta-APP42). This suggests a role in molecular pathways associated with amyloid-induced cell death. TM2D1 Protein, Human (HEK293, Fc) is the recombinant human-derived TM2D1 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of TM2D1 Protein, Human (HEK293, Fc) is 81 a.a., with molecular weight of 45-60 KDa.

The TM2D1 protein is suggested to potentially participate in amyloid-beta-induced apoptosis through its interaction with beta-APP42, specifically interacting with amyloid-beta protein 42 (APP beta-APP42). This implies a role for TM2D1 in the molecular pathways associated with amyloid-beta-induced cell death, particularly through its association with the beta-APP42 protein. The precise mechanisms and consequences of this interaction remain areas of interest, highlighting TM2D1's potential involvement in cellular processes related to amyloid-beta signaling and apoptosis.

Human

HEK293

C-mFc

Q9BX74/NP_114416.1 (T38-G118)

83941  [NCBI]

TSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNG

Approximately 45-60 kDa band in SDS-PAGE under reducing conditions due to the glycosylation.

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.