1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins
  4. Tetraspanin 7/CD231
  5. TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His)

TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P77495
Handling Instructions Technical Support

TM4SF2/TSPAN7 protein is an important member of the tetraspanin family and plays an important role in signal transduction, cell adhesion, and membrane organization. Its research enhances understanding of cell membrane dynamics and provides potential applications in cell biology and cancer research. TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag. The total length of TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His) is 101 a.a., with molecular weight of 20-28 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TM4SF2/TSPAN7 protein is an important member of the tetraspanin family and plays an important role in signal transduction, cell adhesion, and membrane organization. Its research enhances understanding of cell membrane dynamics and provides potential applications in cell biology and cancer research. TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag. The total length of TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His) is 101 a.a., with molecular weight of 20-28 kDa.

Background

The TM4SF2/TSPAN7 Protein is a pivotal member of the tetraspanin (TM4SF) family, highlighting its essential role in various cellular processes, including signal transduction, cell adhesion, and membrane organization. As part of this family, TM4SF2/TSPAN7 likely shares conserved structural and functional features with related proteins, emphasizing its involvement in the formation of tetraspanin-enriched microdomains and interactions with other cellular molecules. The classification within the tetraspanin family underscores its specific designation within the broader context of membrane proteins, providing insights into its unique contributions to cell membrane dynamics. The study of TM4SF2/TSPAN7 contributes to our understanding of its role in diverse physiological processes, offering potential applications in cell biology, cancer research, and a deeper comprehension of its broader impact on cellular functions. Further exploration of TM4SF2/TSPAN7's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.

Biological Activity

When Recombinant Cynomolgus TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-TSPAN7 Antibody. The ED50 for this effect is 171.7 ng/mL.

Species

Cynomolgus

Source

HEK293

Tag

N-His

Accession

Q4R5A3 (R113-M213)

Gene ID
Molecular Construction
N-term
His
TM4SF2 (R113-M213)
Accession # Q4R5A3
C-term
Synonyms
Tetraspanin-7; Tspan-7; CD231; Mxs1; Tm4sf2
AA Sequence

RHEIKDTFLRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLDHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Weight

Approximately 17-28 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P77495
Quantity:
MCE Japan Authorized Agent: