1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins
  4. Tetraspanin 7/CD231
  5. TM4SF2/TSPAN7 Protein, Mouse (HEK293, His)

The TM4SF2/TSPAN7 protein may be involved in cell proliferation and motility and play a role in regulating these processes, but the specific mechanism remains unclear. Its involvement in proliferation suggests importance for cell growth, while its role in motility suggests a potential contribution to cell motility and migration. TM4SF2/TSPAN7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag. The total length of TM4SF2/TSPAN7 Protein, Mouse (HEK293, His) is 101 a.a., with molecular weight of 23-29 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TM4SF2/TSPAN7 protein may be involved in cell proliferation and motility and play a role in regulating these processes, but the specific mechanism remains unclear. Its involvement in proliferation suggests importance for cell growth, while its role in motility suggests a potential contribution to cell motility and migration. TM4SF2/TSPAN7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag. The total length of TM4SF2/TSPAN7 Protein, Mouse (HEK293, His) is 101 a.a., with molecular weight of 23-29 kDa.

Background

TM4SF2/TSPAN7 protein is potentially involved in both cell proliferation and cell motility. It may play a role in regulating these processes, although the exact mechanisms are still unclear. Its involvement in cell proliferation suggests that it may be important for cellular growth and division, while its role in cell motility indicates its potential contribution to movement and migration of cells. Further research is needed to fully understand the specific functions and regulatory pathways in which TM4SF2/TSPAN7 protein participates.

Biological Activity

When Recombinant Mouse TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-TSPAN7 Antibody, The ED50 for this effect is 64.8 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q62283 (R113-M213)

Gene ID
Molecular Construction
N-term
TM4SF2 (R113-M213)
Accession # Q62283
His
C-term
Synonyms
Tetraspanin-7; Tspan-7; CD231; Mxs1; Tm4sf2
AA Sequence

RHEIKDTFLRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Weight

Approximately 19-30 kDa due to the glycosylation

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TM4SF2/TSPAN7 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TM4SF2/TSPAN7 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74507
Quantity:
MCE Japan Authorized Agent: