1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins
  4. Tetraspanin 7/CD231
  5. TM4SF2/TSPAN7 Protein, Rat (HEK293, His)

TM4SF2/TSPAN7 protein is a highly expressed tetraspanin that is involved in synaptic transmission, neuronal morphogenesis, DCs, and osteoblast morphogenesis. Additionally, it plays a key role in tumorigenesis, promotion, and metastasis. TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is the recombinant rat-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TM4SF2/TSPAN7 protein is a highly expressed tetraspanin that is involved in synaptic transmission, neuronal morphogenesis, DCs, and osteoblast morphogenesis. Additionally, it plays a key role in tumorigenesis, promotion, and metastasis. TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is the recombinant rat-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.

Background

TM4SF2/TSPAN7 Protein regulates the transport of α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors, participates in synaptic transmission, neuronal morphogenesis, and DCs and osteoblasts morphogenesis. M4SF2/TSPAN7 Protein participates in the spinal maturation of cultured hippocampal neurons through direct interaction with PICK1[1].
Overexpression of TM4SF2/TSPAN7 protein promotes the formation of filopodia and dendritic spines in embryonic rat hippocampal neuronal cultures. Silencing of TM4SF2/TSPAN7 protein reduces head size and spine stability as well as AMPA receptor currents.[2].
TM4SF2/TSPAN7 protein promotes the epithelial-mesenchymal transition (EMT) process by reducing the expression of E-cadherin and vimentin, thereby promoting the proliferation and migration of non-small cell lung cancer (NSCLC) cells[3] TM4SF2/TSPAN7 Protein induces apoptosis and cell cycle arrest in bladder cancer cell lines. TM4SF2/TSPAN7 Protein inhibits the growth of bladder cancer cells by activating Bax, cleaved Caspase-3 and PTEN and inactivating Bcl-2, p-PI3K and p-AKT[4].

Biological Activity

When Recombinant Rat TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-TSPAN7 Antibody. The ED50 for this effect is 173.6 ng/mL.

Species

Rat

Source

HEK293

Tag

N-His

Accession

ABX10436 (R108-M208)

Gene ID
Molecular Construction
N-term
His
TM4SF2 (R108-M208)
Accession # ABX10436
C-term
Synonyms
Tetraspanin-7; Tspan-7; CD231; Mxs1; Tm4sf2
AA Sequence

RHEIKDTFLRTYTDAMQNYNGKDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLEHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Weight

Approximately 18-28 kDa

Purity

Greater than 85% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TM4SF2/TSPAN7 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TM4SF2/TSPAN7 Protein, Rat (HEK293, His)
Cat. No.:
HY-P76677
Quantity:
MCE Japan Authorized Agent: