TM4SF2/TSPAN7 Protein, Rat (HEK293, His)

TM4SF2/TSPAN7 protein is a highly expressed tetraspanin that is involved in synaptic transmission, neuronal morphogenesis, DCs, and osteoblast morphogenesis. Additionally, it plays a key role in tumorigenesis, promotion, and metastasis. TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is the recombinant rat-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag. The total length of TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is 101 a.a., with molecular weight of ~13.9 kDa.

TM4SF2/TSPAN7 Protein regulates the transport of α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors, participates in synaptic transmission, neuronal morphogenesis, and DCs and osteoblasts morphogenesis. M4SF2/TSPAN7 Protein participates in the spinal maturation of cultured hippocampal neurons through direct interaction with PICK1^[1].
Overexpression of TM4SF2/TSPAN7 protein promotes the formation of filopodia and dendritic spines in embryonic rat hippocampal neuronal cultures. Silencing of TM4SF2/TSPAN7 protein reduces head size and spine stability as well as AMPA receptor currents.^[2].
TM4SF2/TSPAN7 protein promotes the epithelial-mesenchymal transition (EMT) process by reducing the expression of E-cadherin and vimentin, thereby promoting the proliferation and migration of non-small cell lung cancer (NSCLC) cells^[3] TM4SF2/TSPAN7 Protein induces apoptosis and cell cycle arrest in bladder cancer cell lines. TM4SF2/TSPAN7 Protein inhibits the growth of bladder cancer cells by activating Bax, cleaved Caspase-3 and PTEN and inactivating Bcl-2, p-PI3K and p-AKT^[4].

When Recombinant Rat TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Anti-TSPAN7 Antibody. The ED₅₀ for this effect is 173.6 ng/mL.

Rat

HEK293

N-His

ABX10436 (R108-M208)

363447  [NCBI]

RHEIKDTFLRTYTDAMQNYNGKDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLEHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

Approximately 18-28 kDa

Greater than 85% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.