TMEM156 Protein, Human (HEK293, His)

TMEM156 Protein is a member of transmembrane proteins (TMEM) family. The expression levels of TMEM156 correlates with patient survival. TMEM156 is upregulated in tumor tissue. Many genes positively correlated with TMEM156 are involved in multiple immunological processes. Furthermore, genes negatively correlated with TMEM156 are linked with RHO GTPase effectors, which results in a poorer response to receptor activation, thus reducing cancer cell proliferation, survival, and migration. TMEM156 Protein, Human (HEK293, His) is the recombinant human-derived TMEM156 protein, expressed by HEK293 , with C-His labeled tag. The total length of TMEM156 Protein, Human (HEK293, His) is 186 a.a., with molecular weight of ~23 KDa.

Transmembrane protein 156 (TMEM156) is a member of transmembrane proteins (TMEM) family. The expression levels of TMEM156 correlates with patient survival. TMEM156 is upregulated in tumor tissue. The expression of TMEM156 shows significant correlation with immune, stromal, and ESTIMATE scores which indicates a strong association between TMEM156 and immune response inside a tumor microenvironment. Many genes positively correlated with TMEM156 are involved in multiple immunological processes. Furthermore, genes negatively correlated with TMEM156 are linked with RHO GTPase effectors, which results in a poorer response to receptor activation, thus reducing cancer cell proliferation, survival, and migration^[1].

Human

HEK293

C-His

AAH30803.1 (K26-S211)

80008  [NCBI]

KTPKERTLELSCLEVCLQSNFTYSLSSLNFSFVTFLQPVRETQIIMRIFLNPSNFRNFTRTCQDITGEFKMCSSCLVCEPKGNMDFISQEQTSKVLIRRGSMEVKANDFHSPCQHFNFSVAPLVDHLEEYNTTCHLKNHTGRSTIMEDEPSKEKSINYTCRIMEYPNDCIHISLHLEMDIKNITCS

Approximately 35-55 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.