1. Recombinant Proteins
  2. Others
  3. TMEM25 Protein, Human (HEK293, His)

TMEM25 Protein, Human (HEK293, His)

Cat. No.: HY-P77245
COA Handling Instructions

TMEM25 Protein, crucial in neurons, modulates the degradation of the NMDA receptor GRIN2B subunit, influencing the intricate regulation of neuronal excitability. Its interaction with GRIN2B highlights its role in dynamic processes central to neurotransmission and synaptic function. TMEM25 Protein, Human (HEK293, His) is the recombinant human-derived TMEM25 protein, expressed by HEK293 , with C-His labeled tag. The total length of TMEM25 Protein, Human (HEK293, His) is 198 a.a., with molecular weight of ~43 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $40 In-stock
10 μg $70 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
500 μg $950 In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TMEM25 Protein, crucial in neurons, modulates the degradation of the NMDA receptor GRIN2B subunit, influencing the intricate regulation of neuronal excitability. Its interaction with GRIN2B highlights its role in dynamic processes central to neurotransmission and synaptic function. TMEM25 Protein, Human (HEK293, His) is the recombinant human-derived TMEM25 protein, expressed by HEK293 , with C-His labeled tag. The total length of TMEM25 Protein, Human (HEK293, His) is 198 a.a., with molecular weight of ~43 kDa.

Background

TMEM25 protein serves a crucial role in neurons by modulating the degradation of the NMDA receptor GRIN2B subunit, contributing to the intricate regulation of neuronal excitability. Its interaction with GRIN2B underscores its involvement in the dynamic processes underlying neurotransmission and synaptic function.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q86YD3-2/AAH51841.1(E27-P224)

Gene ID
Molecular Construction
N-term
TMEM25 (E27-P224)
Accession # Q86YD3-2/AAH51841.1
His
C-term
Synonyms
Transmembrane protein 25; TMEM25
AA Sequence

ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAP

Molecular Weight

Approximately 32-60 kDa due to glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TMEM25 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMEM25 Protein, Human (HEK293, His)
Cat. No.:
HY-P77245
Quantity:
MCE Japan Authorized Agent: