TNF-alpha/TNFSF2 Protein, Sheep (GST)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (GST) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-GST labeled tag. The total length of TNF-alpha/TNFSF2 Protein, Sheep (GST) is 157 a.a., with molecular weight of 44.2 kDa.

TNF-alpha/TNFSF2 Protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is primarily secreted by macrophages and has multiple biological activities. It can induce cell death in certain tumor cell lines and acts as a potent pyrogen, causing fever either through direct action or by stimulating interleukin-1 secretion. TNF-alpha/TNFSF2 Protein is also implicated in the induction of cachexia. Under specific conditions, it can stimulate cell proliferation and promote cell differentiation. Additionally, it induces insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, while also leading to GKAP42 protein degradation, which contributes to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein plays a role in angiogenesis by synergistically inducing VEGF production with IL1B and IL6. Moreover, it facilitates osteoclastogenesis and, consequently, mediates bone resorption. Lastly, the TNF intracellular domain (ICD) form of TNF-alpha/TNFSF2 Protein stimulates IL12 production in dendritic cells.

Sheep

E. coli

N-GST

P23383 (L78-L234)

443540  [NCBI]

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

44.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.