TNFRH3/TNFRSF26 Protein, Mouse (HEK293, Fc)

TNFRH3/TNFRSF26 protein is significantly expressed in the thymus and spleen, indicating that it plays a crucial role in regulating immune system function. Its presence in the thymus, a key organ for T-cell development, underscores its important role in overseeing fundamental cellular processes required for immune maturation. TNFRH3/TNFRSF26 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TNFRH3/TNFRSF26 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TNFRH3/TNFRSF26 Protein, Mouse (HEK293, Fc) is 143 a.a., with molecular weight of ~42.8 KDa.

The TNFRH3/TNFRSF26 protein, a member of the tumor necrosis factor receptor superfamily, is expressed in key immune organs, including the thymus and spleen. This receptor, is also detectable at notable levels in the lung. As part of the tumor necrosis factor receptor family, TNFRH3 likely plays a role in mediating immune responses and cellular processes associated with inflammation. The specific expression pattern in immune-related organs and the presence in the lung indicate its potential involvement in immune regulation and surveillance, underscoring its significance in maintaining immune homeostasis and responding to external stimuli. Further exploration of TNFRH3's functions could shed light on its precise role in immune modulation and potential implications for health and disease.

Immobilized Recombinant Mouse TNFRH3 at 2μg/mL (100 μL/well) can bind Recombinant Mouse TRAIL/TNFSF10. The ED₅₀ for this effect is 248.6 ng/mL.

Mouse

HEK293

C-hFc

P83626/NP_783580.1 (S20-K162)

244237  [NCBI]

SVNTITLCKIGEFKHENLCCLQCSAGTYLRNPCQENHNKSECAPCDSEHFIDHKNRESECFPCSVCRDDQEEVAKCSRTADRVCQCKQGTYCDSENCLERCHTCSSCPDGRVVRKCNATMDTVCDKFDSEPGQSGSQCFCFSK

Approximately 45-50 kDa.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.