1. Recombinant Proteins
  2. Receptor Proteins
  3. TREML1 Protein, Human (147a.a, HEK293, hFc)

TREML1 is a trigger receptor 1 expressed on myeloid cells that activates myeloid cells via the adaptor protein DAP12. TREML1 promotes microglial phagocytosis of Aβ and is associated with the immune response to AD. TREML1 Protein, Human (147a.a, HEK293, hFc) is the recombinant human-derived TREML1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TREML1 is a trigger receptor 1 expressed on myeloid cells that activates myeloid cells via the adaptor protein DAP12. TREML1 promotes microglial phagocytosis of Aβ and is associated with the immune response to AD. TREML1 Protein, Human (147a.a, HEK293, hFc) is the recombinant human-derived TREML1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

TREML1 is a trigger receptor 1 expressed on myeloid cells, and monocytes/macrophages and blood neutrophils are the main effector cells in the innate response to human TREML1. TREML1 activates myeloid cells through the adaptor protein DAP12. TREMs family not only participate in the regulation of microglial phagocytosis and amyloid clearance but also play an indispensable role in the neuroinflammatory response of AD. TREML1 promotes microglial phagocytosis of Aβ and is associated with the immune response to AD[1][2][3].

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q86YW5/XP_016866312.1 (Q16-P162)

Gene ID
Molecular Construction
N-term
TREML1 (Q16-P162)
Accession # Q86YW5/XP_016866312.1
hFc
C-term
Synonyms
TLT-1; TREML1; TLT1; Trem-like transcript 1; UNQ1825/PRO3438; dJ238O23.3; GLTL1825; MGC119173; PRO3438
AA Sequence

QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIP

Molecular Weight

Approximately 50-60 kDa due to glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 8% Trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TREML1 Protein, Human (147a.a, HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TREML1 Protein, Human (147a.a, HEK293, hFc)
Cat. No.:
HY-P701054
Quantity:
MCE Japan Authorized Agent: