TRP1 Protein, Human (HEK293, His)

TRP1 (tyrosinase-related protein 1) is critical in melanin biosynthesis and catalyzes the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) to indole-5,6-quinone-2- Carboxylic acids, especially in the presence of Cu(2+) ions. This activity is inhibited by Zn(2+). TRP1 Protein, Human (HEK293, His) is the recombinant human-derived TRP1 protein, expressed by HEK293 , with C-His labeled tag. The total length of TRP1 Protein, Human (HEK293, His) is 447 a.a., with molecular weight of ~60-75 kDa.

TRP1 (Tyrosinase-related protein 1) plays a crucial role in melanin biosynthesis, as evidenced by its involvement in the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid, particularly in the presence of bound Cu(2+) ions. Notably, this enzymatic activity is inhibited in the presence of Zn(2+). TRP1 is implicated in regulating the type of melanin synthesized, thus influencing pigmentation processes. Additionally, to a lesser extent, TRP1 exhibits hydroxylating activity on tyrosine, contributing to melanin production. The multifaceted functions of TRP1 underscore its significance in melanogenesis and highlight its potential role in determining the characteristics of melanin generated in the skin.

Measured by its ability to catalyze the formation of dopachrome from L-dopa. The specific activity is 73.524 U/mg, as measured under the described conditions.

Human

HEK293

C-10*His

P17643 (Q25-R471)

7306  [NCBI]

QFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSR

Approximately 60-75 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.