TTN Protein, Human (His)

The TTN protein is critical for vertebrate striated muscle assembly, establishing microfilament connections that are critical for sarcomeric force balance. TTN coordinates cross-link size and extensibility, shaping sarcomere extensibility and muscle function. TTN Protein, Human (His) is the recombinant human-derived TTN protein, expressed by E. coli , with N-His labeled tag. The total length of TTN Protein, Human (His) is 207 a.a., with molecular weight of ~26.5 kDa.

TTN, a crucial player in the assembly and operation of vertebrate striated muscles, assumes a pivotal role by establishing connections at the individual microfilament level. This contribution becomes instrumental in maintaining the delicate balance of forces within the sarcomere halves. The size and extensibility of the cross-links, orchestrated by TTN, emerge as key determinants shaping the extensibility properties of the sarcomere and, consequently, muscle function. Beyond its myocentric duties, TTN extends its influence to non-muscle cells, where it appears to participate in vital processes such as chromosome condensation and segregation during mitosis. In this context, TTN's potential roles include acting as a link between the lamina network and chromatin or nuclear actin, or potentially both, during the interphase of the cell cycle. This multifaceted engagement underscores TTN's significance in both muscle physiology and cellular dynamics.

Human

E. coli

N-His

Q8WZ42 (5398V-5604T)

7273  [NCBI]

VFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTLT

Approximately 26.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.