TXNL4A Protein, Human (His)

The TXNL4A protein plays a key role in pre-mRNA splicing and is an important component of U5 snRNP, U4/U6-U5 tri-snRNP complex, and precatalytic spliceosome (spliceosome B complex). It contributes to spliceosome assembly and is an integral part of the complex process of spliceosome function. TXNL4A Protein, Human (His) is the recombinant human-derived TXNL4A protein, expressed by E. coli , with N-His labeled tag. The total length of TXNL4A Protein, Human (His) is 142 a.a., with molecular weight of ~14 kDa.

TXNL4A protein is integral to pre-mRNA splicing, serving as a critical component in the U5 snRNP and U4/U6-U5 tri-snRNP complexes, both essential for spliceosome assembly and the formation of the precatalytic spliceosome (spliceosome B complex). Within the U4/U6-U5 tri-snRNP complex, comprising U4, U6, and U5 snRNAs, TXNL4A collaborates with various proteins, including PRPF3, PRPF4, PRPF6, PRPF8, and others, to create a foundation for the precatalytic spliceosome. Its direct interaction with CD2BP2 and association with proteins like HNRPF, HNRPH2, NEDD9, and PQBP1 highlight TXNL4A's multifaceted involvement in the intricate machinery orchestrating pre-mRNA splicing. Additionally, TXNL4A interacts with ERBB4, showcasing its potential connections to broader cellular processes.

Human

E. coli

N-His

P83876 (M1-Y142)

10907  [NCBI]

MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

Approximately 14 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.