UBE2D4 Protein, Human (GST)

UBE2D4 Protein, a vital ubiquitin-proteasome system component, acts as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to proteins. In vitro, UBE2D4 demonstrates versatility by promoting polyubiquitination with all seven ubiquitin Lys residues, potentially favoring 'Lys-11' and 'Lys-48'-linked polyubiquitination. This dynamic ubiquitin chain range suggests UBE2D4's involvement in diverse cellular processes and regulatory pathways, highlighting its significance in the intricate network of protein degradation and turnover. UBE2D4 Protein, Human (GST) is the recombinant human-derived UBE2D4 protein, expressed by E. coli, with N-GST labeled tag. The total length of UBE2D4 Protein, Human (GST) is 147 a.a., with molecular weight of ~40.0 kDa.

UBE2D4, a crucial component of the ubiquitin-proteasome system, operates as an E2 ubiquitin-conjugating enzyme by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to other proteins. In vitro, UBE2D4 showcases its versatility by demonstrating the ability to promote polyubiquitination using all seven ubiquitin Lys residues, with a potential preference for 'Lys-11' and 'Lys-48'-linked polyubiquitination. This dynamic range of ubiquitin chain linkages suggests UBE2D4's involvement in diverse cellular processes and regulatory pathways, emphasizing its significance in the intricate network of protein degradation and turnover.

Human

E. coli

N-GST

Q9Y2X8 (M1-M147)

51619  [NCBI]

MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM

Approximately 40.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.