UCHL3 Protein, Rat (His)

The UCHL3 protein is a deubiquitinating enzyme (DUB) that complexly controls cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, UCHL3 selectively recognizes and hydrolyzes the peptide bond of ubiquitin or the C-terminal glycine of NEDD8, showing a 10-fold preference for Arg and Lys at the P3 position, and has a special preference for "Lys-48" linked ubiquitin chains. affinity. UCHL3 Protein, Rat (His) is the recombinant rat-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag. The total length of UCHL3 Protein, Rat (His) is 229 a.a., with molecular weight of ~28 kDa.

UCHL3 Protein, a deubiquitinating enzyme (DUB), intricately governs cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. Functioning as a thiol protease, UCHL3 selectively recognizes and hydrolyzes peptide bonds at the C-terminal glycine of ubiquitin or NEDD8, displaying a notable 10-fold preference for Arg and Lys at position P3 and a particular affinity for 'Lys-48'-linked ubiquitin chains. In apical compartments, UCHL3 deubiquitinates ENAC, thereby finely regulating apical membrane recycling. Its influence extends to insulin signaling and adipogenesis, indirectly enhancing the phosphorylation of IGFIR, AKT, and FOXO1. Essential for stress-response in retinal, skeletal muscle, and germ cell maintenance, UCHL3 may also play a role in working memory. Notably, it exhibits the capability to hydrolyze UBB(+1), a mutated form of ubiquitin resistant to proteasomal degradation, emphasizing its significance in the dynamic control of cellular processes and homeostasis.

The specific activity of UCHL3 was 68.654 nmoL/min/mg in DUB assay using ubiquitin-based proluciferin as substrate.

Rat

E. coli

N-His

Q91Y78 (E2-A230)

498560  [NCBI]

EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSALKKFLEESVAMSPEERARHLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Approximately 28 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.