ULBP-6/RAET1L Protein, Human (HEK293, His)

ULBP-6/RAET1L Protein, a key immune response modulator, activates the KLRK1/NKG2D receptor, triggering natural killer (NK) cell cytotoxicity. This engagement is pivotal for the immune system's defense against threats, showcasing ULBP-6/RAET1L's orchestration of NK cell responses. Its specificity is highlighted by the absence of a binding association with beta2-microglobulin in molecular interactions. ULBP-6/RAET1L Protein, Human (HEK293, His) is the recombinant human-derived ULBP-6/RAET1L protein, expressed by HEK293, with C-His labeled tag. The total length of ULBP-6/RAET1L Protein, Human (HEK293, His) is 192 a.a., with molecular weight of ~23.2 KDa.

NKG2DL2, a key participant in immune response modulation, exerts its influence by binding to and activating the KLRK1/NKG2D receptor. This interaction serves as a pivotal trigger for natural killer (NK) cell cytotoxicity, a fundamental aspect of the immune system's defense against various threats. NKG2DL2's ability to engage with KLRK1/NKG2D underscores its role in orchestrating NK cell responses. Notably, it does not form a binding association with beta2-microglobulin, further elucidating the specificity of its molecular interactions.

Measured by its binding ability in a functional ELISA. When Recombinant Human NKG2D/CD314 is immobilized at 1 μg/mL (100 μL/well) can bind Human ULBP-6/RAET1L. The ED₅₀ for this effect is 27.800 ng/mL.

Human

HEK293

C-His

Q5VY80 (R26-S217)

154064  [NCBI]

RRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS

Approximately 27-33 kDa due to the glycosylation

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.