ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc)

The ULBP1/RAET1I protein is critical in the cytotoxicity of natural killer cells and can bind to and activate the KLRK1/NKG2D receptor. This mechanism highlights the importance of ULBP1/RAET1I in mediating cytotoxic responses. ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc) is the recombinant human-derived ULBP1/RAET1I protein, expressed by HEK293 , with C-hFc, C-Myc labeled tag. The total length of ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc) is 191 a.a., with molecular weight of ~52.4 kDa.

The ULBP1/RAET1I protein plays a crucial role in natural killer cell cytotoxicity by acting as a ligand that binds to and activates the KLRK1/NKG2D receptor. This binding and activation mechanism highlights the significance of ULBP1/RAET1I in mediating the cytotoxic responses of natural killer cells. Moreover, it is noteworthy that ULBP1/RAET1I does not exhibit binding to beta2-microglobulin. This characteristic interaction profile underscores the specificity and selectivity of ULBP1/RAET1I in its engagement with KLRK1/NKG2D, emphasizing its pivotal role in immune responses and its potential as a therapeutic target for modulating natural killer cell activity.

Human

HEK293

C-hFc;C-Myc

Q9BZM6 (G26-G216)

80329  [NCBI]

GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

Approximately 52.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.