1. Recombinant Proteins
  2. Others
  3. ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc)

ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc)

Cat. No.: HY-P72023
Handling Instructions Technical Support

The ULBP1/RAET1I protein is critical in the cytotoxicity of natural killer cells and can bind to and activate the KLRK1/NKG2D receptor. This mechanism highlights the importance of ULBP1/RAET1I in mediating cytotoxic responses. ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc) is the recombinant human-derived ULBP1/RAET1I protein, expressed by HEK293 , with C-hFc, C-Myc labeled tag. The total length of ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc) is 191 a.a., with molecular weight of ~52.4 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ULBP1/RAET1I protein is critical in the cytotoxicity of natural killer cells and can bind to and activate the KLRK1/NKG2D receptor. This mechanism highlights the importance of ULBP1/RAET1I in mediating cytotoxic responses. ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc) is the recombinant human-derived ULBP1/RAET1I protein, expressed by HEK293 , with C-hFc, C-Myc labeled tag. The total length of ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc) is 191 a.a., with molecular weight of ~52.4 kDa.

Background

The ULBP1/RAET1I protein plays a crucial role in natural killer cell cytotoxicity by acting as a ligand that binds to and activates the KLRK1/NKG2D receptor. This binding and activation mechanism highlights the significance of ULBP1/RAET1I in mediating the cytotoxic responses of natural killer cells. Moreover, it is noteworthy that ULBP1/RAET1I does not exhibit binding to beta2-microglobulin. This characteristic interaction profile underscores the specificity and selectivity of ULBP1/RAET1I in its engagement with KLRK1/NKG2D, emphasizing its pivotal role in immune responses and its potential as a therapeutic target for modulating natural killer cell activity.

Species

Human

Source

HEK293

Tag

C-hFc;C-Myc

Accession

Q9BZM6 (G26-G216)

Gene ID
Molecular Construction
N-term
ULBP1 (G26-G216)
Accession # Q9BZM6
hFc-Myc
C-term
Synonyms
ALCAN-beta; NKG2D ligand 1; N2DL-1; NKG2DL1; Retinoic acid early transcript 1I;
AA Sequence

GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

Molecular Weight

Approximately 52.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc)
Cat. No.:
HY-P72023
Quantity:
MCE Japan Authorized Agent: