1. Recombinant Proteins
  2. Others
  3. ULBP3 Protein, Human (HEK293, His)

ULBP3 Protein, Human (HEK293, His)

Cat. No.: HY-P702558
SDS COA Handling Instructions

The ULBP3 protein plays a key role in natural killer cell cytotoxicity and activates the KLRK1/NKG2D receptor. The interaction of ULBP3 highlights its importance in mediating cytotoxic responses. ULBP3 Protein, Human (HEK293, His) is the recombinant human-derived ULBP3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ULBP3 Protein, Human (HEK293, His) is 187 a.a., with molecular weight of ~59 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $58 In-stock
10 μg $150 In-stock
50 μg $390 In-stock
100 μg $620 In-stock
250 μg $1185 In-stock
> 250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ULBP3 protein plays a key role in natural killer cell cytotoxicity and activates the KLRK1/NKG2D receptor. The interaction of ULBP3 highlights its importance in mediating cytotoxic responses. ULBP3 Protein, Human (HEK293, His) is the recombinant human-derived ULBP3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ULBP3 Protein, Human (HEK293, His) is 187 a.a., with molecular weight of ~59 kDa.

Background

The ULBP3 protein plays a pivotal role in natural killer cell cytotoxicity by functioning as a ligand that binds to and activates the KLRK1/NKG2D receptor. ULBP3 mediates the cytotoxic responses of natural killer cells. Through its binding affinity with KLRK1/NKG2D, ULBP3 facilitates the activation of this receptor, contributing to the recognition and targeting of cells marked for elimination. Importantly, ULBP3 does not exhibit binding to beta2-microglobulin, as indicated by similarities in its interaction profile. This insight into the binding characteristics of ULBP3 further delineates its role as a key player in immune responses, specifically in the orchestration of natural killer cell activity.

Biological Activity

Measured by its binding ability in a functional ELISA.When Recombinant Human NKG2D/CD314 (HY-P70688) is immobilized at 2 μg/mL (100 μL/well) can bind Recombinant Human ULBP-3. The ED50 for this effect is 1.127 μg/mL.

  • Measured by its binding ability in a functional ELISA.When Recombinant Human NKG2D/CD314 (HY-P70688) is immobilized at 2 μg/mL (100 μL/well) can bind Recombinant Human ULBP-3. The ED50 for this effect is 1.127 μg/mL.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9BZM4/NP_078794 (D30-P216)

Gene ID

79465

Molecular Construction
N-term
ULBP3 (D30-P216)
Accession # Q9BZM4/NP_078794
6*His
C-term
Synonyms
NKG2D ligand 3; RAET1N; UL16 binding protein 3; ULBP3; ULBP-3
AA Sequence

DAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAP

Molecular Weight

Approximately 25-31 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 6.2, 8% trehalose.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ULBP3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ULBP3 Protein, Human (HEK293, His)
Cat. No.:
HY-P702558
Quantity:
MCE Japan Authorized Agent: