ULBP3 Protein, Human (HEK293, His)

The ULBP3 protein plays a key role in natural killer cell cytotoxicity and activates the KLRK1/NKG2D receptor. The interaction of ULBP3 highlights its importance in mediating cytotoxic responses. ULBP3 Protein, Human (HEK293, His) is the recombinant human-derived ULBP3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ULBP3 Protein, Human (HEK293, His) is 187 a.a., with molecular weight of ~59 kDa.

The ULBP3 protein plays a pivotal role in natural killer cell cytotoxicity by functioning as a ligand that binds to and activates the KLRK1/NKG2D receptor. ULBP3 mediates the cytotoxic responses of natural killer cells. Through its binding affinity with KLRK1/NKG2D, ULBP3 facilitates the activation of this receptor, contributing to the recognition and targeting of cells marked for elimination. Importantly, ULBP3 does not exhibit binding to beta2-microglobulin, as indicated by similarities in its interaction profile. This insight into the binding characteristics of ULBP3 further delineates its role as a key player in immune responses, specifically in the orchestration of natural killer cell activity.

Measured by its binding ability in a functional ELISA.When Recombinant Human NKG2D/CD314 (HY-P70688) is immobilized at 2 μg/mL (100 μL/well) can bind Recombinant Human ULBP-3. The ED₅₀ for this effect is 1.127 μg/mL.

Human

HEK293

C-6*His

Q9BZM4/NP_078794 (D30-P216)

79465

DAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAP

Approximately 25-31 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 6.2, 8% trehalose.

<0.1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.