VAPB Protein, Human (His)

VAPB protein interacts with STARD3 through a phosphorylation-dependent mechanism to form a contact site between the endoplasmic reticulum (ER) and late endosomes. VAPB Protein, Human (His) is the recombinant human-derived VAPB protein, expressed by E. coli , with C-6*His labeled tag. The total length of VAPB Protein, Human (His) is 131 a.a., with molecular weight of ~17.0 kDa.

VAPB Protein, an endoplasmic reticulum-anchored protein, plays a crucial role in the formation of contact sites between the endoplasmic reticulum (ER) and late endosomes through its interaction with STARD3 in a phosphorylation-dependent manner of the FFAT motif. Beyond its structural involvement, VAPB contributes to the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Additionally, it is implicated in the regulation of cellular calcium homeostasis. VAPB exists as a homodimer and forms heterodimers with VAPA. Its interactome extends to include proteins such as VAMP1, VAMP2, ZFYVE27, RMDN3, KIF5A, STARD3, STARD3NL, CERT1, PLEKHA3, SACM1L, and VPS13A, underscoring its versatility in participating in diverse cellular processes. The interactions with RB1CC1, MIGA2, OSBPL1A, KCNB1, and KCNB2, involving phosphorylated FFAT motifs, highlight the intricate regulatory networks in which VAPB is engaged. This comprehensive network of interactions emphasizes the pivotal role of VAPB in coordinating essential cellular processes at the ER-endosome interface.

Human

E. coli

C-6*His

O95292 (A2-P132)

9217  [NCBI]

AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKP

Approximately 17.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.