1. Recombinant Proteins
  2. Others
  3. VSTM1 Protein, Human (119a.a, HEK293, His)

VSTM1 interacts with S100A10 protein, inducing the dimerization of ANXA2/p36. This suggests a regulatory role in protein phosphorylation, with ANXA2 monomer being the preferred target for tyrosine-specific kinase in vitro. The resulting heterotetramer comprises two light chains of S100A10/p11 and two heavy chains of ANXA2/p36. Furthermore, VSTM1 engages with SCN10A and TASOR, indicating its participation in diverse molecular interactions. VSTM1 Protein, Human (119a.a, HEK293, His) is the recombinant human-derived VSTM1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VSTM1 Protein, Human (119a.a, HEK293, His) is 119 a.a., with molecular weight of 25-35 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VSTM1 interacts with S100A10 protein, inducing the dimerization of ANXA2/p36. This suggests a regulatory role in protein phosphorylation, with ANXA2 monomer being the preferred target for tyrosine-specific kinase in vitro. The resulting heterotetramer comprises two light chains of S100A10/p11 and two heavy chains of ANXA2/p36. Furthermore, VSTM1 engages with SCN10A and TASOR, indicating its participation in diverse molecular interactions. VSTM1 Protein, Human (119a.a, HEK293, His) is the recombinant human-derived VSTM1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VSTM1 Protein, Human (119a.a, HEK293, His) is 119 a.a., with molecular weight of 25-35 kDa.

Background

S100A10 protein induces the dimerization of ANXA2/p36, suggesting a regulatory role in protein phosphorylation, where the ANXA2 monomer is the preferred target for tyrosine-specific kinase in vitro. The protein forms a heterotetramer, consisting of two light chains of S100A10/p11 and two heavy chains of ANXA2/p36. Additionally, S100A10 interacts with SCN10A and TASOR, indicating its involvement in various molecular interactions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q6UX27 (Y17-T135)

Gene ID
Molecular Construction
N-term
VSTM1 (Y17-T135)
Accession # Q6UX27
6*His
C-term
Synonyms
V-set and transmembrane domain-containing protein 1; SIRL-1; Signal inhibitory receptor on leukocytes-1; VSTM1
AA Sequence

YEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRT

Molecular Weight

25-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

VSTM1 Protein, Human (119a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VSTM1 Protein, Human (119a.a, HEK293, His)
Cat. No.:
HY-P71428
Quantity:
MCE Japan Authorized Agent: