1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. Wee1 Protein, Human (Sf9, His)

Wee1 Protein acts as a crucial negative regulator of the G2 to M transition, ensuring nuclear protection by phosphorylating CDK1 on 'Tyr-15' and inactivating the cyclin B1-CDK1 complex. Its peak activity in G2 phase decreases as cells progress into M phase, with dynamic regulation, increased phosphorylation during S and G2 phases, and diminished levels during M/G1 phase transition potentially due to degradation. Wee1 Protein, Human (Sf9, His) is the recombinant human-derived Wee1 protein, expressed by Sf9 insect cells , with N-8*His labeled tag. The total length of Wee1 Protein, Human (Sf9, His) is 285 a.a., .

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Wee1 Protein acts as a crucial negative regulator of the G2 to M transition, ensuring nuclear protection by phosphorylating CDK1 on 'Tyr-15' and inactivating the cyclin B1-CDK1 complex. Its peak activity in G2 phase decreases as cells progress into M phase, with dynamic regulation, increased phosphorylation during S and G2 phases, and diminished levels during M/G1 phase transition potentially due to degradation. Wee1 Protein, Human (Sf9, His) is the recombinant human-derived Wee1 protein, expressed by Sf9 insect cells , with N-8*His labeled tag. The total length of Wee1 Protein, Human (Sf9, His) is 285 a.a., .

Background

Wee1 Protein functions as a critical negative regulator of the G2 to M transition, preventing entry into mitosis by safeguarding the nucleus from the activation of cytoplasmically bound cyclin B1-complexed CDK1. Through the phosphorylation of CDK1 on 'Tyr-15,' Wee1 specifically targets and inactivates the cyclin B1-CDK1 complex, with its activity peaking during the G2 phase and reaching a minimum as cells progress into M phase. Notably, Wee1's phosphorylation of cyclin B1-CDK1 occurs exclusively on 'Tyr-15,' while monomeric CDK1 remains unphosphorylated. Its activity undergoes dynamic regulation, increasing during S and G2 phases and diminishing at M phase, accompanied by hyperphosphorylation. Additionally, a correlated reduction in Wee1 protein levels occurs during the M/G1 phase transition, potentially attributed to its degradation.

Species

Human

Source

Sf9 insect cells

Tag

N-8*His

Accession

P30291 (M291-K575)

Gene ID

7465

Molecular Construction
N-term
8*His
Wee1 (M291-K575)
Accession # P30291
C-term
Synonyms
WEE1; Wee1-like protein kinase; WEE1hu; Wee1A kinase
AA Sequence

MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK

Molecular Weight

34.2 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 200 mM NaCl, 20% glycerol, 1 mM DTT, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Wee1 Protein, Human (Sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Wee1 Protein, Human (Sf9, His)
Cat. No.:
HY-P701727
Quantity:
MCE Japan Authorized Agent: