Wee1 Protein, Human (Sf9, His)

Wee1 Protein acts as a crucial negative regulator of the G2 to M transition, ensuring nuclear protection by phosphorylating CDK1 on 'Tyr-15' and inactivating the cyclin B1-CDK1 complex. Its peak activity in G2 phase decreases as cells progress into M phase, with dynamic regulation, increased phosphorylation during S and G2 phases, and diminished levels during M/G1 phase transition potentially due to degradation. Wee1 Protein, Human (Sf9, His) is the recombinant human-derived Wee1 protein, expressed by Sf9 insect cells , with N-8*His labeled tag. The total length of Wee1 Protein, Human (Sf9, His) is 285 a.a., .

Wee1 Protein functions as a critical negative regulator of the G2 to M transition, preventing entry into mitosis by safeguarding the nucleus from the activation of cytoplasmically bound cyclin B1-complexed CDK1. Through the phosphorylation of CDK1 on 'Tyr-15,' Wee1 specifically targets and inactivates the cyclin B1-CDK1 complex, with its activity peaking during the G2 phase and reaching a minimum as cells progress into M phase. Notably, Wee1's phosphorylation of cyclin B1-CDK1 occurs exclusively on 'Tyr-15,' while monomeric CDK1 remains unphosphorylated. Its activity undergoes dynamic regulation, increasing during S and G2 phases and diminishing at M phase, accompanied by hyperphosphorylation. Additionally, a correlated reduction in Wee1 protein levels occurs during the M/G1 phase transition, potentially attributed to its degradation.

Human

Sf9 insect cells

N-8*His

P30291 (M291-K575)

7465

MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK

34.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 200 mM NaCl, 20% glycerol, 1 mM DTT, pH 7.5.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.