1. Recombinant Proteins
  2. Enzymes & Regulators
  3. XPNPEP3 Protein, Human (His)

The XPNPEP3 protein catalyzes the removal of prolyl residues from N-terminal peptides (such as Leu-Pro-Ala) and has low activity towards Ala or Ser at the P1 site. XPNPEP3 Protein, Human (His) is the recombinant human-derived XPNPEP3 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of XPNPEP3 Protein, Human (His) is 507 a.a., with molecular weight of ~65.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The XPNPEP3 protein catalyzes the removal of prolyl residues from N-terminal peptides (such as Leu-Pro-Ala) and has low activity towards Ala or Ser at the P1 site. XPNPEP3 Protein, Human (His) is the recombinant human-derived XPNPEP3 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of XPNPEP3 Protein, Human (His) is 507 a.a., with molecular weight of ~65.0 kDa.

Background

The XPNPEP3 protein serves a crucial role in peptide processing by catalyzing the removal of a penultimate prolyl residue from the N-termini of peptides, exemplified by substrates like Leu-Pro-Ala. Additionally, it exhibits low activity towards peptides featuring Ala or Ser at the P1 position. Beyond its peptidase function, XPNPEP3 demonstrates an intriguing role as it promotes TNFRSF1B-mediated phosphorylation of MAPK8/JNK1 and MAPK9/JNK2, indicating a potential function as an adapter protein for TNFRSF1B. Notably, this effect is independent of XPNPEP3's peptidase activity, suggesting a dual role in cellular signaling pathways. Furthermore, XPNPEP3 may play a role in inhibiting apoptotic cell death induced via TNF-TNFRSF1B signaling, underlining its involvement in cellular processes beyond peptide cleavage.

Species

Human

Source

E. coli

Tag

N-6*His;C-6*His

Accession

Q9NQH7 (M1-S507)

Gene ID
Molecular Construction
N-term
6*His
XPNPEP3 (M1-S507)
Accession # Q9NQH7
6*His
C-term
Synonyms
Probable Xaa-Pro Aminopeptidase 3; X-Pro Aminopeptidase 3; Aminopeptidase P3; APP3; XPNPEP3
AA Sequence

MPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPLILSADCPKEMNDIEQICSQAS

Molecular Weight

Approximately 65.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

XPNPEP3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
XPNPEP3 Protein, Human (His)
Cat. No.:
HY-P71435
Quantity:
MCE Japan Authorized Agent: