YTFE Protein, E.coli (GST)

YTFE protein is a diiron-containing molecule that is crucially involved in the repair of iron-sulfur clusters under oxidative and nitrosative stress conditions. As a homodimer, YTFE plays a key role in mitigating damage to iron-sulfur clusters, a process necessary to maintain the integrity and function of various proteins within cells. YTFE Protein, E.coli (GST) is the recombinant E. coli-derived YTFE protein, expressed by E. coli , with N-GST labeled tag. The total length of YTFE Protein, E.coli (GST) is 220 a.a., with molecular weight of 51.9 kDa.

YTFE, a di-iron-containing protein, plays a vital role in the repair of iron-sulfur clusters that are susceptible to damage under conditions of oxidative and nitrosative stress. Operating as a homodimer, YTFE is implicated in cellular responses to environmental stresses that may compromise the integrity of iron-sulfur clusters, critical co-factors in various biological processes. The di-iron centers within YTFE likely contribute to its function as a repair enzyme, facilitating the restoration of damaged iron-sulfur clusters and ensuring the proper functioning of proteins dependent on these clusters for their activities.

E.coli

E. coli

N-GST

P69506 (M1-E220)

66671871  [NCBI]

MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE

51.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.