1. Peptides
  2. Peptide and Derivatives
  3. Peptide Epitopes
  4. Tag Peptides
  5. 3X HA Tag

3X HA Tag is a biological active peptide. (This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.)

For research use only. We do not sell to patients.

Custom Peptide Synthesis

3X HA Tag Chemical Structure

3X HA Tag Chemical Structure

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

3X HA Tag is a biological active peptide. (This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.)

In Vivo

1. 3X HA Tag was amplified from pMPY-3HA plasmid series[1]. The pMPY-3xHA was constructed by ligating a NotI 3xHA fragment into the NotI site of pBluescript 11 SK-, yielding plasmid pGTEP1. A SmaI URA3 fragment from pJJ242 was blunt-end ligated into the SmaI site of pBluescript II SK- in both orientations to create vectors pWS8931 and pWS8932. An XbaI-EcoRI URA3 fragment of pWS8931 was ligated into the XbaI EcoRI cut pGTEPl to create pGTEP1 -URA3. Primers HA-up 5’-ACGATCGTCGAATTCGA GCTCATCTTTTACCCATACGAT-3’ and HA-down 5’-TTCGACTGACTCGAGACTAGTAGC GTAATCTGGAACGTC-3’ were used to amplify the 3x HA epitope. This PCR fragment was digested with EcoRI and XhoI and ligated to the similarly restricted pGTEPl -URA3 vector to create the final product, pMPY-3xHA.
2. 3xHA Tag can be used for western blot and immunofluorescence detection of fusion protein[2].
(1) On day1, Add a total of 1.5 x 104 Hela cells per well of a 24-well plate. Bring to 1.5 mL of complete DMEM per well and move to 37℃ incubator overnight (o/n).
(2) On day2, remove media from each well and replace with 0.5 mL of complete DMEM. Transfect 500 ng of pCDNA3-VAMP8-3xHA into Hela cells. Incubate 6 hours at 37℃ in the tissue culture incubator. Remove the media and replace with 1.5 mL of complete DMEM. Incubate overnight in the 37℃ tissue culture incubator.
(3) On day3, wash transfected cells with 1 mL of ice-cold DMEM for two washes. Remove all the media. Dilute rabbit anti-HA antibody in ice cold complete DMEM to a final dilution of 1:200. Add 150 μL of diluted anti-HA antibody to each well. Incubate on ice for 60 min. Wash cells three times with 1mL of ice-cold complete DMEM. Wash cells two times with 1 mL of pre-warmed EBSS (37℃). Add 1 mL of pre-warmed EBSS to each well, and incubate in the 37℃ tissue culture incubator for 15, 45 and 90 min.
(4) At each time point, remove the appropriate coverglass and transfer into a new well of a new 24-well plate containing 1 mL of 1x PBS. Remove the 1x PBS, and replace with 1 mL of the 4% paraformaldehyde solution. Incubate for 15 min at room temperature. Remove 4% paraformaldehyde solution, and wash three times with 1 mL of 1x PBS. For each wash, incubate 5 min at room temperature. Remove last wash and block in 1 mL of blocking buffer for 1 h at room temperature. Dilute mouse anti-Lamp1 or mouse anti-EEA1 to final dilutions of 1:100 or 1:1,000, respectively, in antibody incubation buffer. Remove blocking buffer and replace with 100 μl of the appropriately diluted antibody, and incubate at 4 ℃ o/n. Remove diluted antibody solution, and wash 3 times with 1 mL of 1x PBS. For each wash, incubate 5 min at room temperature. Dilute Alexa-coupled secondary antibodies. Dilute goat anti-mouse Alexa-488 and goat anti-rabbit Alexa-546 to a final dilution of 1:250 in antibody dilution buffer. Remove wash solution, add 200 μl of diluted secondary antibody solution, and incubate 1 h at room temperature in the dark to minimize photobleaching. Remove secondary antibody-containing solution, and wash three times with 1 mL of 1x PBS. For each wash, incubate 5 min at room temperature. Add 200 μl of 1x PBS containing 1 μg/mL of DAPI and incubate 5 min at room temperature. Remove DAPI-containing solution and wash twice with 1 mL of 1x PBS. For each wash, incubate 5 min at room temperature. Pipet 10 μl of FluorSave mounting media on a microscope slide. Remove coverglass from individual wells using forceps, and gently remove as much liquid as possible. Gently drop the coverglass onto the slide and the mounting media, making sure that no air bubbles are trapped between the coverglass and the slide. Remove extra mounting solution, and let the slide cure o/n at 4 ℃. Image on an appropriate confocal or widefield microscopy system.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4372.63

Formula

C205H272N38O67S

Appearance

Solid

Color

White to off-white

Sequence

Met-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Lys-Leu-Glu

Sequence Shortening

MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (22.87 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2287 mL 1.1435 mL 2.2870 mL
5 mM 0.0457 mL 0.2287 mL 0.4574 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2287 mL 1.1435 mL 2.2870 mL 5.7174 mL
5 mM 0.0457 mL 0.2287 mL 0.4574 mL 1.1435 mL
10 mM 0.0229 mL 0.1143 mL 0.2287 mL 0.5717 mL
15 mM 0.0152 mL 0.0762 mL 0.1525 mL 0.3812 mL
20 mM 0.0114 mL 0.0572 mL 0.1143 mL 0.2859 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
3X HA Tag
Cat. No.:
HY-P5491
Quantity:
MCE Japan Authorized Agent: