2. Anti-infection
  3. SARS-CoV
  4. Aviptadil

Aviptadil  (Synonyms: Vasoactive Intestinal Peptide (human, rat, mouse, rabbit, canine, porcine))

Cat. No.: HY-P0012 Purity: 99.87%
SDS COA Handling Instructions

Molarity Calculator

Aviptadil is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Aviptadil Chemical Structure

Aviptadil Chemical Structure

CAS No. : 40077-57-4

Size Price Stock Quantity
1 mg USD 144 In-stock
5 mg USD 300 In-stock
10 mg USD 420 In-stock
50 mg USD 780 In-stock
100 mg   Get quote  
200 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Aviptadil:

Aviptadil Related Antibodies

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Aviptadil

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Aviptadil is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al[1][2][3][4][5].

In Vivo

Aviptadil (500 μg/kg; Intravenous injection; Every other day; Three weeks) completely prevented and significantly reversed Monocrotaline (MCT) (HY-N0750) -induced Pulmonary Arterial Hypertension in Sprague Dawley rat models (PAH)). Aviptadil is synergistic with Bosentan (HY-A0013)[3].
Aviptadil (150 μg/kg/d; Intraperitoneal pump; 2.5 μl/h; 4 weeks) can eliminate bronchial hyperreactivity (BHR) in Sprague-Dawley rats, with a characteristic of bronchiectasis[3].
Aviptadil (0.1, 3 μg/kg; Intravenous injection (i.v.)) can improve reperfusion injury in living rat lung transplantation models[5].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Sprague Dawley rats
Dosage: Bosentan (HY-A0013 ) 300 mg/kg, Aviptadil 500 μg/kg
Administration: Bosentan (HY-A0013 ) Oral gavage (p.o); Aviptadil Intraperitoneal injection (i.p)
Result: Starting on day 21, the rats treated with Bosentan or Aviptadil alone had a 29% reduction in mortality (P< 0.0001). No death was observed in the rats during the same time period.
Clinical Trial
Molecular Weight

3325.80

Formula

C147H238N44O42S
CAS No.
Appearance

Solid

Color

White to off-white

Sequence Shortening

HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : 100 mg/mL (30.07 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.3007 mL 1.5034 mL 3.0068 mL
5 mM 0.0601 mL 0.3007 mL 0.6014 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.87%

SDS (252 KB)

COA (242 KB) LCMS (90 KB)

Handling Instructions (2659 KB)
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.3007 mL 1.5034 mL 3.0068 mL 7.5170 mL
5 mM 0.0601 mL 0.3007 mL 0.6014 mL 1.5034 mL
10 mM 0.0301 mL 0.1503 mL 0.3007 mL 0.7517 mL
15 mM 0.0200 mL 0.1002 mL 0.2005 mL 0.5011 mL
20 mM 0.0150 mL 0.0752 mL 0.1503 mL 0.3758 mL
25 mM 0.0120 mL 0.0601 mL 0.1203 mL 0.3007 mL
30 mM 0.0100 mL 0.0501 mL 0.1002 mL 0.2506 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Aviptadil Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Aviptadil40077-57-4Vasoactive Intestinal Peptide (human, rat, mouse, rabbit, canine, porcine)SARS-CoVSARS coronavirusRespiratory FailureSarcoidPulmonary FibrosisBronchospasmRespiratory Distress Syndrome ARDSLung InjuryALISarcoidosisSARS-CoV-2Corona VirusInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Aviptadil
Cat. No.:
HY-P0012
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.