Adrenotensin (human)  (Synonyms: Pro-ADM-153-185 (human))

Adrenotensin (human) (Pro-ADM-153-185 (human)) is a 153-185 fragment of precursor peptide of Adrenomedullin. Adrenomedullin (ADM) is a 52-amino acid multifunctional peptide, which belongs to the CGRP superfamily of vasoactive peptide hormones^[1].

The human Adrenomedullin (ADM) peptide is encoded by a single gene, which is located on chromosome 11 and consists of four exons and three introns. Translation of the transcript generates the 185 amino acid precursor peptide prepro-ADM, which is subsequently converted into the 164 amino acid pro-ADM by cleavage of the N-terminal signal-peptide. Pro-ADM is further processed into proADM N-terminal 20 peptide (PAMP), midregional pro-ADM, Adrenotensin Pro-ADM-153-185 and immature ADM, a C-terminally glycine-extended version of ADM^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

3219.56

C₁₄₃H₂₂₄N₄₂O₄₃

166546-72-1

SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Ria Schönauer, et al. Adrenomedullin-new perspectives of a potent peptide hormone. J Pept Sci. 2017 Jul;23(7-8):472-485.  [Content Brief]