[Ala2,8,9,11,19,22,24,25,27,28]-VIP

Cat. No.: HY-P1158: FAQs
Data Sheet Handling Instructions

Molarity Calculator

[Ala2,8,9,11,19,22,24,25,27,28]-VIP is an analog vasoactive intestinal polypeptide (VIP) with high affinity and selectivity for human VIP/pituitary adenylate cyclase-activating polypeptide 1 (hVPAC1). VIP is a widespread neurotransmitter.

For research use only. We do not sell to patients.

[Ala2,8,9,11,19,22,24,25,27,28]-VIP Chemical Structure

CAS No. : 866552-34-3

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description	[Ala2,8,9,11,19,22,24,25,27,28]-VIP is an analog vasoactive intestinal polypeptide (VIP) with high affinity and selectivity for human VIP/pituitary adenylate cyclase-activating polypeptide 1 (hVPAC1). VIP is a widespread neurotransmitter^[1].
Molecular Weight	2928.46
Formula	C₁₃₁H₂₁₉N₄₁O₃₃S
CAS No.	866552-34-3
Sequence	His-Ala-Asp-Ala-Val-Phe-Thr-Ala-Ala-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Ala-Lys-Lys-Ala-Leu-Ala-Ala-Ile-Ala-Ala-NH2
Sequence Shortening	HADAVFTAAYARLRKQMAAKKALAAIAA-NH2
SMILES	N[C@@H](CC1=CN=CN1)C(N[C@@H](C)C(N[C@@H](CC(O)=O)C(N[C@@H](C)C(N[C@@H](C(C)C)C(N[C@H](C(N[C@@H]([C@H](O)C)C(N[C@@H](C)C(N[C@@H](C)C(N[C@H](C(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCSC)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](C)C(N[C@@H](CC(C)C)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](C)C(N[C@@H](C)C(N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC2=CC=C(C=C2)O)=O)=O)=O)=O)CC3=CC=CC=C3)=O)=O)=O)=O)=O
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (258 KB) Handling Instructions (2659 KB)
References	[1]. Hisato Igarashi, et al. Development of simplified vasoactive intestinal peptide analogs with receptor selectivity and stability for human vasoactive intestinal peptide/pituitary adenylate cyclase-activating polypeptide receptors. J Pharmacol Exp Ther. 2005 Oct;315(1):370-81. [Content Brief]