Anthopleurin-A

Cat. No.: HY-P4898: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Anthopleurin-A is a soidum channel toxin. Anthopleurin-A is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A can be isolated from the sea anemone.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Anthopleurin-A Chemical Structure

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Anthopleurin-A:

Anthopleurin-A TFA Get quote

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Sodium Channel Isoform Specific Products:

View All Isoforms

Na_v1.1 Na_v1.2 Na_v1.3 Na_v1.4 Na_v1.5 Na_v1.6 Na_v1.7 Na_v1.8

Biological Activity
Purity & Documentation
References
Customer Review

Description	Anthopleurin-A is a soidum channel toxin. Anthopleurin-A is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A can be isolated from the sea anemone^[1]^[2].
In Vitro	Anthopleurin-A (2 nM-640 nM) increases the force of contractions of isolated cat heart papillary muscles^[2]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Anthopleurin-A Related Antibodies
In Vivo	Anthopleurin-A (0.2 μg/kg/min i.v.) increases myocardial contractile force in anesthetized dogs^[2]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Molecular Weight	5131.72
Formula	C₂₂₀H₃₂₆N₆₄O₆₇S₆
Sequence	Gly-Val-Ser-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Thr-Leu-Trp-Leu-Tyr-Pro-Ser-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Ala-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln (Disulfide bridge: Cys4-Cys46,Cys6-Cys36,Cys29- Cys47)
Sequence Shortening	GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ (Disulfide bridge: Cys4-Cys46,Cys6-Cys36,Cys29- Cys47)
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (260 KB) Handling Instructions (2659 KB)
References	[1]. Honma T, Shiomi K. Peptide toxins in sea anemones: structural and functional aspects. Mar Biotechnol (NY). 2006 Jan-Feb;8(1):1-10. [Content Brief] [2]. Scriabine A, et al. Cardiotonic effects of anthopleurin-A, a polypeptide from a sea anemone. J Cardiovasc Pharmacol. 1979 Sep-Oct;1(5):571-83. [Content Brief]

Anthopleurin-A Related Classifications

Cardiovascular Disease

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Anthopleurin-ASodium ChannelNa channelsNa+ channelstoxincardiac channelcardiotonicsea anemoneInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name

Lot #