Apo A-I mimetic 5A peptide 

Apo A-I mimetic 5A peptide is a synthetic peptide molecule designed based on the structure and function of naturally occurring apolipoprotein A-I (Apo A-I). Apo A-I mimetic 5A peptide can promote the efflux of cholesterol from cells and help reduce the accumulation of cholesterol in cells. Apo A-I mimetic 5A peptide also shows anti-inflammatory activity and can reduce inflammatory markers in blood and tissues. Apo A-I mimetic 5A peptide can be used in the study of cardiovascular diseases^[1].

4217.73

C₁₉₇H₂₉₅N₄₇O₅₆

Asp-Trp-Leu-Lys-Ala-Phe-Tyr-Asp-Lys-Val-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Phe-Pro-Asp-Trp-Ala-Lys-Ala-Ala-Tyr-Asp-Lys-Ala-Ala-Glu-Lys-Ala-Lys-Glu-Ala-Ala

DWLKAFYDKVAEKLKEAFPDWAKAAYDKAAEKAKEAA

O=C(N[C@@H](CC1=CNC2=CC=CC=C12)C(N[C@@H](CC(C)C)C(N[C@@H](CCCCN)C(N[C@@H](C)C(N[C@@H](CC3=CC=CC=C3)C(N[C@@H](CC4=CC=C(C=C4)O)C(N[C@@H](CC(O)=O)C(N[C@@H](CCCCN)C(N[C@@H](C(C)C)C(N[C@@H](C)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](CCCCN)C(N[C@@H](CCC(O)=O)C(N[C@@H](C)C(N[C@@H](CC5=CC=CC=C5)C(N6[C@@H](CCC6)C(N[C@@H](CC(O)=O)C(N[C@@H](CC7=CNC8=CC=CC=C78)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CC9=CC=C(C=C9)O)C(N[C@@H](CC(O)=O)C(N[C@@H](CCCCN)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCCN)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](CCC(O)=O)C(N[C@@H](C)C(N[C@@H](C)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC(O)=O)N

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Liu X, et al. Serum apolipoprotein AI depletion is causative to silica nanoparticles–induced cardiovascular damage[J]. Proceedings of the National Academy of Sciences, 2021, 118(44): e2108131118.  [Content Brief]