1. Peptides
  2. Peptide and Derivatives
  3. Hormones and Neuropeptides
  4. [Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2

[Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2 is a vasoactive intestinal polypeptide (VIP) analog with relaxant effects.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

[Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2 Chemical Structure

[Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2 Chemical Structure

CAS No. : 186844-13-3

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

[Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2 is a vasoactive intestinal polypeptide (VIP) analog with relaxant effects[1].

In Vitro

[Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2 contains an altered amino acid sequence both N- and C-terminally, which makes it more basic in nature[1].
[Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2 (0.1, 0.3, or 1 μM; 0-6 hours) produces significant and concentration-dependent tracheal smooth-muscle relaxation in guinea pig trachea[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3733.20

Formula

C162H267N57O45

CAS No.
Sequence Shortening

HSDAVFTDNYTRLRRQLAVRRYLNSILNGKR-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

[Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2 Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
[Arg15,20,21, Leu17] VIP-Gly-Lys-Arg-NH2
Cat. No.:
HY-P4013
Quantity:
MCE Japan Authorized Agent: