ATX-II

Cat. No.: HY-P1604: FAQs
Data Sheet Handling Instructions

Molarity Calculator

ATX-II is a specific Na⁺ channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II causes delayed inactivation of the Na⁺Halothane (HY-B1010), Caffeine, and Ryanodine (HY-103306). ATX-II also induces pulmonary vein arrhythmogenesis and atrial fibrillation.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

ATX-II Chemical Structure

CAS No. : 60748-45-0

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of ATX-II:

ATX-II TFA Get quote

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Sodium Channel Isoform Specific Products:

View All Isoforms

Na_v1.1 Na_v1.2 Na_v1.3 Na_v1.4 Na_v1.5 Na_v1.6 Na_v1.7 Na_v1.8

Biological Activity
Purity & Documentation
References
Customer Review

Description	ATX-II is a specific Na⁺ channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II causes delayed inactivation of the Na⁺Halothane (HY-B1010), Caffeine, and Ryanodine (HY-103306). ATX-II also induces pulmonary vein arrhythmogenesis and atrial fibrillation^[1]^[2].
Molecular Weight	4934.62
Formula	C₂₁₃H₃₂₃N₆₃O₆₁S₆
CAS No.	60748-45-0
Sequence	Gly-Val-Pro-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Ile-Ile-Trp-Leu-Ala-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Lys-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln (Disulfide bonds: Cys4-Cys44, Cys6-Cys34, Cys27-Cys45)
Sequence Shortening	GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ (Disulfide bonds: Cys4-Cys44, Cys6-Cys34, Cys27-Cys45)
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (259 KB) Handling Instructions (2659 KB)
References	[1]. Fletcher JE, et al. ATX II, a sodium channel toxin, sensitizes skeletal muscle to halothane, caffeine, and ryanodine. Anesthesiology. 1999 May;90(5):1294-301. [Content Brief] [2]. Lu YY, et al. ATX-II-induced pulmonary vein arrhythmogenesis related to atrial fibrillation and long QT syndrome. Eur J Clin Invest. 2012 Aug;42(8):823-31. [Content Brief]

ATX-II Related Classifications

Inflammation/Immunology

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

ATX-II60748-45-0Sodium ChannelNa channelsNa+ channelsPulmonary veinarrhythmogenesisatrial fibrillationNa+ channeltoxinInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name

Lot #