2. Metabolic Enzyme/Protease
  3. Endogenous Metabolite
  4. C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse

C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse 

Cat. No.: HY-P10720
Handling Instructions

Molarity Calculator

C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse is an activator of particulate guanylate cyclase B (pGC-B), which is highly expressed in endothelial cells, kidneys, and the heart. C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse can mediate a potent anti-fibrotic effect in human cardiac and renal fibroblasts by generating the second messenger cGMP.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse Chemical Structure

C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse Chemical Structure

CAS No. : 129405-72-7

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse is an activator of particulate guanylate cyclase B (pGC-B), which is highly expressed in endothelial cells, kidneys, and the heart. C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse can mediate a potent anti-fibrotic effect in human cardiac and renal fibroblasts by generating the second messenger cGMP[1].
Molecular Weight

5796.68

Formula

C251H414N82O70S3
CAS No.
Sequence

Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-His-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Gly-Asn-Lys-Lys-Gly-Leu- Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfidebridge:Cys37-Cys53)
Sequence Shortening

DLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGSMSGLGC (Disulfidebridge:Cys37-Cys53)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse129405-72-7Endogenous MetabolitepGC-BcGMPanti-fibrosisInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse
Cat. No.:
HY-P10720
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.