Calcitonin (salmon) (acetate) (Synonyms: Salmon calcitonin acetate)

Cat. No.: HY-P0090A: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption.The acetate form can affect the absorption and efficacy of hormones.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Calcitonin (salmon) (acetate) Chemical Structure

CAS No. : 158000-61-4

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Calcitonin (salmon) (acetate):

Calcitonin (salmon)

Other Forms of Calcitonin (salmon) (acetate):

Calcitonin (salmon) In-stock

1 Publications Citing Use of MCE Calcitonin (salmon) (acetate)

•J Cell Mol Med. 2020 Aug;24(15):8650-8661. [Abstract]

: Calcitonin (salmon) (acetate) purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2020 Aug;24(15):8650-8661. [Abstract]; Calcitonin increases phosphorylated PKC-ε but reduces phosphorylated PKC-δ, which are antagonistic to the effects of IL-1 treatment.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description	Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption^[1].The acetate form can affect the absorption and efficacy of hormones^[2].
Molecular Weight	3431.85 (free base)
Formula	C₁₄₅H₂₄₀N₄₄O₄₈S₂.xC₂H₄O₂
CAS No.	158000-61-4
Sequence	Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Sequence Shortening	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7)
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (282 KB) Handling Instructions (2659 KB)
References	[1]. Feigh M, et al. Oral salmon calcitonin attenuates hyperglycaemia and preserves pancreatic beta-cell area and function in Zucker diabetic fatty rats. Br J Pharmacol. 2012 Sep;167(1):151-63. [Content Brief] [2].

Calcitonin (salmon) (acetate) Related Classifications

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Calcitonin (salmon) (acetate)158000-61-4Salmon calcitoninCGRP ReceptorCalcitonin gene-related peptide receptorPeptide hormoneOsteoporosisCalcium homeostasisInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name

Lot #