Ceratotoxin-2 (Synonyms: CcoTx2; β-TRTX-cm1b)

Cat. No.: HY-P5810: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel blocker with IC₅₀s of 8 nM and 88 nM against Na_v1.2/β₁ and Na_v1.3/β₁, respectively.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Ceratotoxin-2 Chemical Structure

CAS No. : 880885-98-3

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Sodium Channel Isoform Specific Products:

View All Isoforms

Na_v1.1 Na_v1.2 Na_v1.3 Na_v1.4 Na_v1.5 Na_v1.6 Na_v1.7 Na_v1.8

Biological Activity
Purity & Documentation
References
Customer Review

Description	Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel blocker with IC₅₀s of 8 nM and 88 nM against Na_v1.2/β₁ and Na_v1.3/β₁, respectively^[1].
IC₅₀ & Target	IC50: 8 nM (Na_v1.2/β₁), 88 nM (Na_v1.3/β₁), 400 nM (Na_v1.4/β₁), 407 nM (Na_v1.1/β₁), 1634 nM (Na_v1.5/β₁)^[1]
Molecular Weight	4092.67
Formula	C₁₇₇H₂₆₀N₅₂O₄₉S₆
CAS No.	880885-98-3
Sequence	Asp-Cys-Leu-Gly-Trp-Phe-Lys-Ser-Cys-Asp-Pro-Lys-Asn-Asp-Lys-Cys-Cys-Lys-Asn-Tyr-Thr-Cys-Ser-Arg-Arg-Asp-Arg-Trp-Cys-Lys-Tyr-Tyr-Leu-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)
Sequence Shortening	DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYYL-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (260 KB) Handling Instructions (2659 KB)
References	[1]. Bosmans F, et al. Four novel tarantula toxins as selective modulators of voltage-gated sodium channel subtypes. Mol Pharmacol. 2006 Feb;69(2):419-29. [Content Brief]

Ceratotoxin-2 Related Classifications

Neurological Disease

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Ceratotoxin-2880885-98-3CcoTx2 β-TRTX-cm1bCeratotoxin2Ceratotoxin 2CcoTx 2CcoTx-2Sodium ChannelNa channelsNa+ channelsCeratogyrus cornuatusX. laevis oocytesInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Email Address *

Phone Number

Department *

Organization Name *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

Ceratotoxin-2 (Synonyms: CcoTx2; β-TRTX-cm1b)

Ceratotoxin-2 Related Antibodies

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Sodium Channel Isoform Specific Products:

Biological Activity

Purity & Documentation

References

Customer Review