Crotamine TFA

Cat. No.: HY-P5159A Purity: 98.06%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

Crotamine TFA is a Na⁺ channel modulator. Crotamine is a 42 amino acid toxin cross-linked by three disulfide bridges. Crotamine has analgesic activity. Crotamine also interacts with lipid membranes and shows myonecrotic activity. Crotamine can be isolated from Crotalus durissus terrificus venom.

For research use only. We do not sell to patients.

Crotamine TFA Chemical Structure

Size	Price	Stock	Quantity
1 mg	USD 840	In-stock	Estimated Time of Arrival: December 31
5 mg	USD 2100	In-stock	Estimated Time of Arrival: December 31
10 mg	USD 3150	In-stock	Estimated Time of Arrival: December 31
50 mg		Get quote
100 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Crotamine TFA:

Crotamine Get quote

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

View All Sodium Channel Isoform Specific Products:

View All Isoforms

Na_v1.1 Na_v1.2 Na_v1.3 Na_v1.4 Na_v1.5 Na_v1.6 Na_v1.7 Na_v1.8

Biological Activity
Purity & Documentation
References
Customer Review

Description

Molecular Weight

4883.73 (free base)

Formula

C₂₁₄H₃₂₆N₆₄O₅₄S₇.xC₂HF₃O₂

Appearance

Solid

Color

White to off-white

Sequence

Tyr-Lys-Gln-Cys-His-Lys-Lys-Gly-Gly-His-Cys-Phe-Pro-Lys-Glu-Lys-Ile-Cys-Leu-Pro-Pro-Ser-Ser-Asp-Phe-Gly-Lys-Met-Asp-Cys-Arg-Trp-Arg-Trp-Lys-Cys-Cys-Lys-Lys-Gly-Ser-Gly (Disulfide bonds：Cys4-Cys36, Cys11-Cys30, Cys18-Cys37)

Sequence Shortening

YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG (Disulfide bonds：Cys4-Cys36, Cys11-Cys30, Cys18-Cys37)

SMILES

O=C(N[C@@H](CCCCN)C(N[C@@H](CCC(N)=O)C(N[C@@H](CSSC[C@@H]1NC2=O)C(N[C@@H](CC3=CNC=N3)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(NCC(NCC(N[C@@H](CC4=CNC=N4)C(N[C@@H](CSSC[C@@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC5=CNC6=CC=CC=C56)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC7=CNC8=CC=CC=C78)C(N[C@H]2CCCCN)=O)=O)=O)=O)=O)NC9=O)C(N[C@@H](CC%10=CC=CC=C%10)C(N%11[C@@H](CCC%11)C(N[C@@H](CCCCN)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCCN)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CSSC[C@@H](C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(NCC(N[C@@H](CO)C(NCC(O)=O)=O)=O)=O)=O)=O)NC1=O)C(N[C@@H](CC(C)C)C(N%12[C@@H](CCC%12)C(N%13[C@@H](CCC%13)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(N[C@@H](CC%14=CC=CC=C%14)C(NCC(N[C@@H](CCCCN)C(N[C@@H](CCSC)C(N[C@H]9CC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC%15=CC=C(C=C%15)O)N.OC(C(F)(F)F)=O.[x]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

H₂O : ≥ 100 mg/mL

*"≥" means soluble, but saturation unknown.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 98.06%

Select Batch:

Data Sheet (295 KB) SDS (252 KB)

COA (280 KB) RP-HPLC (114 KB) MS (212 KB)

Handling Instructions (2659 KB)

References

[1]. Nicastro G, et al. Solution structure of crotamine, a Na+ channel affecting toxin from Crotalus durissus terrificus venom. Eur J Biochem. 2003 May;270(9):1969-79. [Content Brief]

[2]. Kerkis I, et al. Biological versatility of crotamine--a cationic peptide from the venom of a South American rattlesnake. Expert Opin Investig Drugs. 2010 Dec;19(12):1515-25. [Content Brief]

Crotamine TFA Related Classifications

Inflammation/Immunology

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

CrotamineSodium ChannelNa channelsNa+ channelsNa+ channelvenomanalgesictoxinlipid membraneInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks