1. Anti-infection
  2. Bacterial
  3. Enterocin K1

Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Enterocin K1 Chemical Structure

Enterocin K1 Chemical Structure

CAS No. : 2764845-22-7

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections[1].

In Vitro

Enterocin K1 has antibacterial activity against different Enterococci with MIC values ranging from 0.048 mg/mL to 1.56 mg/mL[1].
Enterocin K1 (0.01、0.1 and 1 mg/mL) shows no significant erythrocyte hemolysis is observed in human whole blood[1].
Enterocin K1 (1 mg/mL; 0-48 h) shows the inhibitory effect of it on bacteriocins after incubation in whole blood and plasma was 2-fold higher in plasma than in saline and 2-fold higher in blood than in plasma[1].
Enterocin K1 (10 μl of 1 mg/mL; 24 h) inhibits most of the bacteriocins with MIC values higher than 25 mg/ml in a cross-resistant manner in the spot-on-lawn assay[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Viability Assay[1]

Cell Line: bacteriocin
Concentration: 1 mg/mL
Incubation Time: 8, 24, 48 h
Result: Showed that after 8 h, the MIC of bacteriocin in saline was 0.19 mg/mL, and the MIC of bacteriocin in plasma was 0.78 mg/mL. The MIC of bacteriocin was 1.56 mg/mL in blood, 0.39 mg/mL in saline, 1.56 mg/mL in plasma, and 3.125 mg/m in blood after 48 hours.
Molecular Weight

4564.34

Formula

C218H321N53O51S2

CAS No.
Sequence

Met-Lys-Phe-Lys-Phe-Asn-Pro-Thr-Gly-Thr-Ile-Val-Lys-Lys-Leu-Thr-Gln-Tyr-Glu-Ile-Ala-Trp-Phe-Lys-Asn-Lys-His-Gly-Tyr-Tyr-Pro-Trp-Glu-Ile-Pro-Arg-Cys

Sequence Shortening

MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Enterocin K1
Cat. No.:
HY-P5203
Quantity:
MCE Japan Authorized Agent: