2. Anti-infection
  3. Bacterial
  4. Enterocin K1

Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Enterocin K1 Chemical Structure

Enterocin K1 Chemical Structure

CAS No. : 2764845-22-7

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Enterocin K1 Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections[1].

In Vitro

Enterocin K1 has antibacterial activity against different Enterococci with MIC values ranging from 0.048 mg/mL to 1.56 mg/mL[1].
Enterocin K1 (0.01、0.1 and 1 mg/mL) shows no significant erythrocyte hemolysis is observed in human whole blood[1].
Enterocin K1 (1 mg/mL; 0-48 h) shows the inhibitory effect of it on bacteriocins after incubation in whole blood and plasma was 2-fold higher in plasma than in saline and 2-fold higher in blood than in plasma[1].
Enterocin K1 (10 μl of 1 mg/mL; 24 h) inhibits most of the bacteriocins with MIC values higher than 25 mg/ml in a cross-resistant manner in the spot-on-lawn assay[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Enterocin K1 Related Antibodies

Cell Viability Assay[1]

Cell Line: bacteriocin
Concentration: 1 mg/mL
Incubation Time: 8, 24, 48 h
Result: Showed that after 8 h, the MIC of bacteriocin in saline was 0.19 mg/mL, and the MIC of bacteriocin in plasma was 0.78 mg/mL. The MIC of bacteriocin was 1.56 mg/mL in blood, 0.39 mg/mL in saline, 1.56 mg/mL in plasma, and 3.125 mg/m in blood after 48 hours.
Molecular Weight

4564.34

Formula

C218H321N53O51S2
CAS No.
Sequence

Met-Lys-Phe-Lys-Phe-Asn-Pro-Thr-Gly-Thr-Ile-Val-Lys-Lys-Leu-Thr-Gln-Tyr-Glu-Ile-Ala-Trp-Phe-Lys-Asn-Lys-His-Gly-Tyr-Tyr-Pro-Trp-Glu-Ile-Pro-Arg-Cys
Sequence Shortening

MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Enterocin K1 Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Enterocin K12764845-22-7 EntK1Enterocin K 1Enterocin K-1EntK 1EntK-1BacterialbacteriocinVREinfectionEepenterococciInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Enterocin K1
Cat. No.:
HY-P5203
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.