Ergtoxin-1  (Synonyms: ErgTx1)

Ergtoxin-1 is a potassium channel blocker. Ergtoxin-1 is isolated from the venom of the Mexican scorpion Centruroides noxius. Ergtoxin 1 can block ERG-K⁺ channels in nerve, heart and endocrine cells^[1].

4730.29

C₁₉₃H₂₈₇N₅₉O₆₃S₉

304436-85-9

Asp-Arg-Asp-Ser-Cys-Val-Asp-Lys-Ser-Arg-Cys-Ala-Lys-Tyr-Gly-Tyr-Tyr-Gln-Glu-Cys-Gln-Asp-Cys-Cys-Lys-Asn-Ala-Gly-His-Asn-Gly-Gly-Thr-Cys-Met-Phe-Phe-Lys-Cys-Lys-Cys-Ala (Disulfide bridge:Cys5-Cys23;Cys11-Cys34;Cys20-Cys39;Cys24-Cys41)

DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA (Disulfide bridge:Cys5-Cys23;Cys11-Cys34;Cys20-Cys39;Cys24-Cys41)

O=C([C@@H](N)CC(O)=O)N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H]1CC(O)=O)=O)CCC(N)=O)=O)CSSC[C@H](NC2=O)C(N[C@H]3CCCCN)=O)=O)CCC(O)=O)=O)CCC(N)=O)=O)CC4=CC=C(O)C=C4)=O)CC5=CC=C(O)C=C5)=O)=O)CC6=CC=C(O)C=C6)=O)CCCCN)=O)C)=O)CSSC[C@H](NC7=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H]2CCCCN)=O)CC8=CC=CC=C8)=O)CC9=CC=CC=C9)=O)CCSC)=O)=O)CCCNC(N)=N)=O)CO)=O)CCCCN)=O)CC(O)=O)=O)C(C)C)=O)CSSC[C@H](NC1=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(NCC(NCC(N[C@H]7[C@@H](C)O)=O)=O)=O)CC(N)=O)=O)CC%10=CNC=N%10)=O)=O)C)=O)CC(N)=O)=O)CCCCN)=O)CSSC[C@H](NC3=O)C(N[C@H](C(O)=O)C)=O)=O)=O)CO)=O)CC(O)=O)=O)CCCNC(N)=N

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Scaloni A, et al. Disulfide bridges of ergtoxin, a member of a new sub-family of peptide blockers of the ether-a-go-go-related K+ channel. FEBS Lett. 2000 Aug 18;479(3):156-7.  [Content Brief]