1. Peptides
  2. Peptide and Derivatives
  3. Hormones and Neuropeptides Inhibitors and Substrates
  4. Galanin (2-29) (rat)

Galanin (2-29) (rat)  (Synonyms: Rat galanin(2-29))

Cat. No.: HY-P1133
Handling Instructions Technical Support

Galanin (2-29) (rat) inhibits rat pancreatic protein and CCK-8-stimulated amylase secretion. Galanin (2-29) (rat) is an GAL2R agonist (Ki: 3.5 nM).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Galanin (2-29) (rat) Chemical Structure

Galanin (2-29) (rat) Chemical Structure

CAS No. : 141696-11-9

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Galanin (2-29) (rat) inhibits rat pancreatic protein and CCK-8-stimulated amylase secretion. Galanin (2-29) (rat) is an GAL2R agonist (Ki: 3.5 nM)[1][2].

Molecular Weight

3107.40

Formula

C139H208N42O40

CAS No.
Sequence

Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2

Sequence Shortening

WTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galanin (2-29) (rat)
Cat. No.:
HY-P1133
Quantity:
MCE Japan Authorized Agent: