1. Membrane Transporter/Ion Channel Neuronal Signaling
  2. iGluR
  3. GluN1(356-385)

GluN1 (356-385) is an antigenic peptide against N-methyl-D-aspartate receptor (NMDAR) encephalitis. GluN1 (356-385) has the effect of reducing the density of surface NMDAR clusters in hippocampal neurons. GluN1 (356-385) can be used to study the pathogenesis of anti-NMDAR encephalitis .

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GluN1(356-385) Chemical Structure

GluN1(356-385) Chemical Structure

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products

View All iGluR Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

GluN1 (356-385) is an antigenic peptide against N-methyl-D-aspartate receptor (NMDAR) encephalitis. GluN1 (356-385) has the effect of reducing the density of surface NMDAR clusters in hippocampal neurons. GluN1 (356-385) can be used to study the pathogenesis of anti-NMDAR encephalitis [1].

Molecular Weight

3415.90

Formula

C154H248N46O42

Appearance

Solid

Color

White to off-white

Sequence

Leu-Gln-Asn-Arg-Lys-Leu-Val-Gln-Val-Gly-Ile-Tyr-Asn-Gly-Thr-His-Val-Ile-Pro-Asn-Asp-Arg-Lys-Ile-Ile-Trp-Pro-Gly-Gly-Glu

Sequence Shortening

LQNRKLVQVGIYNGTHVIPNDRKIIWPGGE

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 83.33 mg/mL (24.39 mM; ultrasonic and adjust pH to 3 with 1 M HCL; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2927 mL 1.4637 mL 2.9275 mL
5 mM 0.0585 mL 0.2927 mL 0.5855 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation

Purity: 99.88%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2927 mL 1.4637 mL 2.9275 mL 7.3187 mL
5 mM 0.0585 mL 0.2927 mL 0.5855 mL 1.4637 mL
10 mM 0.0293 mL 0.1464 mL 0.2927 mL 0.7319 mL
15 mM 0.0195 mL 0.0976 mL 0.1952 mL 0.4879 mL
20 mM 0.0146 mL 0.0732 mL 0.1464 mL 0.3659 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GluN1(356-385)
Cat. No.:
HY-P5912
Quantity:
MCE Japan Authorized Agent: