Helospectin I

Cat. No.: HY-P3053: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin I is originally isolated from the salivary gland venom of the lizard Heloderma suspectum.

For research use only. We do not sell to patients.

Helospectin I Chemical Structure

CAS No. : 93438-37-0

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

IC₅₀ & Target

Vasoactive intestinal peptide (VIP)^[1]

In Vitro

Helospectin I (suffusion at 0.1 nM, in bicarbonate buffer for 30 min) evokes significant, sustained and similar vasodilation in the intact hamster cheek pouch^[1].
Helospectin I relaxes the Phenylephrine-contracted rat femoral arteries with pEC₅₀ of 6.82^[2].
Helospectin I (0.1 nM-1 μM) inhibits the binding of 125I-labeled VIP and 125I-secretin to dispersed chief cells^[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Helospectin I (0.03-2 nmol/kg, 100 μL of infusion at the left jugular vein) reduces blood pressure in rats^[2].
Helospectin I (0.1-0.8 nmol /kg, i.v.) increases plasma levels of glucagon in mice^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	SD rats^[2]
Dosage:	0.03, 0.3, 1, 2 nM/kg
Administration:	100 μL of infusion at the left jugular vein, followed by washing the catheter with 100 μL saline.
Result:	Reduced the blood pressure, but was less effective than vasoactive intestinal peptide (VIP) in the low dose range.

Animal Model:	Mice^[3]
Dosage:	0.1, 0.2, 0.4, 0.8 nM /kg
Administration:	Intravenous injection (i.v.)
Result:	Markedly stimulated glucagon secretion, and had no direct action on insulin secretion.

Molecular Weight

4095.63

Formula

C₁₈₃H₂₉₃N₄₇O₅₉

CAS No.

93438-37-0

Sequence Shortening

HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Handling Instructions (2659 KB)

References

[1]. Tsueshita T, et al. Helospectin I and II evoke vasodilation in the intact peripheral microcirculation. Peptides. 2004 Jan;25(1):65-9. [Content Brief]

[2]. Grundemar L, et al. Vascular effects of helodermin, helospectin I and helospectin II: a comparison with vasoactive intestinal peptide (VIP). Br J Pharmacol. 1990 Mar;99(3):526-8. [Content Brief]

[3]. Ahrén B. Effects of helospectin I on insulin and glucagon secretion in the mouse. Br J Pharmacol. 1991 Apr;102(4):916-8. [Content Brief]

[4]. Rai A, et al. Actions of Helodermatidae venom peptides and mammalian glucagon-like peptides on gastric chief cells. Am J Physiol. 1993 Jul;265(1 Pt 1):G118-25. [Content Brief]

Helospectin I Related Classifications

Cardiovascular Disease

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Helospectin I93438-37-0OthersVasodilatoryantihypertensiveblood pressureneuropeptidehamsterfemoral arterieschief cellInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks