1. GPCR/G Protein
  2. GCGR
  3. Helospectin I

Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin I is originally isolated from the salivary gland venom of the lizard Heloderma suspectum.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Helospectin I Chemical Structure

Helospectin I Chemical Structure

CAS No. : 93438-37-0

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin I is originally isolated from the salivary gland venom of the lizard Heloderma suspectum[1][2].

IC50 & Target

Vasoactive intestinal peptide (VIP)[1]

In Vitro

Helospectin I (suffusion at 0.1 nM, in bicarbonate buffer for 30 min) evokes significant, sustained and similar vasodilation in the intact hamster cheek pouch[1].
Helospectin I relaxes the Phenylephrine-contracted rat femoral arteries with pEC50 of 6.82[2].
Helospectin I (0.1 nM-1 μM) inhibits the binding of 125I-labeled VIP and 125I-secretin to dispersed chief cells[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Helospectin I (0.03-2 nmol/kg, 100 μL of infusion at the left jugular vein) reduces blood pressure in rats[2].
Helospectin I (0.1-0.8 nmol /kg, i.v.) increases plasma levels of glucagon in mice[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: SD rats[2]
Dosage: 0.03, 0.3, 1, 2 nM/kg
Administration: 100 μL of infusion at the left jugular vein, followed by washing the catheter with 100 μL saline.
Result: Reduced the blood pressure, but was less effective than vasoactive intestinal peptide (VIP) in the low dose range.
Animal Model: Mice[3]
Dosage: 0.1, 0.2, 0.4, 0.8 nM /kg
Administration: Intravenous injection (i.v.)
Result: Markedly stimulated glucagon secretion, and had no direct action on insulin secretion.
Molecular Weight

4095.63

Formula

C183H293N47O59

CAS No.
Sequence Shortening

HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Helospectin I
Cat. No.:
HY-P3053
Quantity:
MCE Japan Authorized Agent: