1. GPCR/G Protein
  2. GCGR
  3. Helospectin II

Helospectin II is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin II has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin II is originally isolated from the salivary gland venom of the lizard Heloderma suspectum.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Helospectin II Chemical Structure

Helospectin II Chemical Structure

CAS No. : 93585-83-2

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Helospectin II is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin II has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin II is originally isolated from the salivary gland venom of the lizard Heloderma suspectum[1][2].

IC50 & Target

Vasoactive intestinal peptide (VIP) receptor[1]

In Vitro

Helospectin II (suffusion at 0.1 nM, in bicarbonate buffer for 30 min) evokes significant, sustained and similar vasodilation in the intact hamster cheek pouch[1].
Helospectin II relaxes the Phenylephrine-contracted rat femoral arteries with pEC50 of 6.93[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Helospectin II (0.03-2 nmol/kg, 100 μL of infusion at the left jugular vein) reduces blood pressure in rats[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: SD rats[2]
Dosage: 0.03, 0.3, 1, 2 nmol/kg
Administration: 100 μL of infusion at the left jugular vein, followed by washing the catheter with 100 μL saline.
Result: Reduced the blood pressure, but was less effective than vasoactive intestinal peptide (VIP) in the low dose range.
Molecular Weight

4008.55

Formula

C180H288N46O57

CAS No.
Sequence

His-Ser-Asp-Ala-Thr-Phe-Thr-Ala-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Glu-Ser-Ile-Leu-Gly-Ser-Ser-Thr-Ser-Pro-Arg-Pro-Pro-Ser

Sequence Shortening

HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Helospectin II
Cat. No.:
HY-P3050
Quantity:
MCE Japan Authorized Agent: