Huwentoxin-IV TFA

Name: Huwentoxin-IV TFA
Brand: MedChemExpress
SKU: HY-P1220A
Rating: 4.5 (1 reviews)

Cat. No.: HY-P1220A Purity: 98.52%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC₅₀s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Huwentoxin-IV TFA Chemical Structure

Size	Price	Stock	Quantity
1 mg	USD 450	In-stock	Estimated Time of Arrival: December 31
5 mg	USD 1125	In-stock	Estimated Time of Arrival: December 31
10 mg		Get quote
50 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Huwentoxin-IV TFA:

Huwentoxin-IV Get quote

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

View All Sodium Channel Isoform Specific Products:

View All Isoforms

Na_v1.1 Na_v1.2 Na_v1.3 Na_v1.4 Na_v1.5 Na_v1.6 Na_v1.7 Na_v1.8

Biological Activity
Purity & Documentation
References
Customer Review

Description

IC₅₀ & Target^[1]

Nav1.7

26 nM (IC₅₀)

Nav1.3

338 nM (IC₅₀)

Nav1.4

400 nM (IC₅₀)

Nav1.2

150 nM (IC₅₀)

Molecular Weight

4106.78(free base)

Formula

C₁₇₄H₂₇₈N₅₂O₅₁S₆.xC₂HF₃O₂

Appearance

Solid

Color

White to off-white

Sequence

Glu-Cys-Leu-Glu-Ile-Phe-Lys-Ala-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Lys-Leu-Val-Cys-Ser-Arg-Lys-Thr-Arg-Trp-Cys-Lys-Tyr-Gln-Ile-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys24;Cys16-Cys31)

Sequence Shortening

ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys24;Cys16-Cys31)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

H₂O : ≥ 100 mg/mL

*"≥" means soluble, but saturation unknown.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 98.52%

Select Batch:

Data Sheet (291 KB) SDS (252 KB)

COA (276 KB) RP-HPLC (113 KB) MS (226 KB)

Handling Instructions (2659 KB)

References

[1]. Xiao Y, et, al. Tarantula huwentoxin-IV inhibits neuronal sodium channels by binding to receptor site 4 and trapping the domain ii voltage sensor in the closed configuration. J Biol Chem. 2008 Oct 3;283(40):27300-13. [Content Brief]

[2]. Liu Y, et, al. Analgesic effects of Huwentoxin-IV on animal models of inflammatory and neuropathic pain. Protein Pept Lett. 2014; 21(2): 153-8. [Content Brief]