Huwentoxin XVI

Cat. No.: HY-P1078: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Huwentoxin XVI, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC₅₀ of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Huwentoxin XVI Chemical Structure

CAS No. : 1600543-88-1

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Huwentoxin XVI:

Huwentoxin XVI TFA Get quote

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Calcium Channel Isoform Specific Products:

View All Isoforms

N-type calcium channel L-type calcium channel P/Q-type calcium channel T-type calcium channel Calcium Channel

Biological Activity
Purity & Documentation
References
Customer Review

Description

IC₅₀ & Target

N-type calcium channel

Molecular Weight

4437.13

Formula

C₁₉₆H₂₉₂N₅₀O₅₆S₆

CAS No.

1600543-88-1

Sequence

Cys-Ile-Gly-Glu-Gly-Val-Pro-Cys-Asp-Glu-Asn-Asp-Pro-Arg-Cys-Cys-Ser-Gly-Leu-Val-Cys-Leu-Lys-Pro-Thr-Leu-His-Gly-Ile-Trp-Tyr-Lys-Ser-Tyr-Tyr-Cys-Tyr-Lys-Lys (Disulfide bridge:Cys1-Cys16;Cys8-Cys21;Cys15-Cys36)

Sequence Shortening

CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK (Disulfide bridge:Cys1-Cys16;Cys8-Cys21;Cys15-Cys36)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Handling Instructions (2659 KB)

References

[1]. Meichun Deng, et al. Huwentoxin-XVI, an analgesic, highly reversible mammalian N-type calcium channel antagonist from Chinese tarantula Ornithoctonus huwena. Neuropharmacology. 2014 Apr;79:657-67. [Content Brief]

Huwentoxin XVI Related Classifications

Neurological Disease

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Huwentoxin XVI1600543-88-1Calcium ChannelCa2+ channelsCa channelsNeurotoxinanalgesicN-typemammalianpolypeptideInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks