1. Protein Tyrosine Kinase/RTK
  2. Insulin Receptor
  3. Insulin peglispro

Insulin peglispro (BIL) is a basal insulin with a flat, prolonged activity profile. Insulin peglispro can exhibit better glycaemic control compared to conventional insulins.

For research use only. We do not sell to patients.

Insulin peglispro Chemical Structure

Insulin peglispro Chemical Structure

CAS No. : 1200440-65-8

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Insulin peglispro (BIL) is a basal insulin with a flat, prolonged activity profile. Insulin peglispro can exhibit better glycaemic control compared to conventional insulins[1].

In Vivo

Insulin peglispro (BIL) (s.c., 17, 0.45 or 1.15 mg/kg/d, 52 week) has no effect on Crl:CD(SD) rat survival at any dose, resulting in some increase in body weight. Serum glucose concentrations are unaffected at an administered dose of 0.17 mg/kg, while 0.45 mg/kg shows lower serum glucose concentrations at 3 and 6 hours post-dose on day 1[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Clinical Trial
Molecular Weight

8359.32

Formula

C370H566N104O110S4

CAS No.
Sequence

Chain1:Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Lys-Pro-Thrchain 2:Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn(Disulfide chain 1 cys7-chain 2 cys7, Disulfide chain 1 cys19-chain 2 cys20, Disulfide chain 2 cys6-cys11)

Sequence Shortening

Chain1:FVNQHLCGSHLVEALYLVCGERGFFYTKPTChain2:GIVEQCCTSICSLYQLENYCN(Disulfide chain 1 cys7-chain 2 cys7, Disulfide chain 1 cys19-chain 2 cys20, Disulfide chain 2 cys6-cys11)

SMILES

[Chain1:FVNQHLCGSHLVEALYLVCGERGFFYTKPT Chain2:GIVEQCCTSICSLYQLENYCN (Disulfide chain 1 cys7-chain 2 cys7, Disulfide chain 1 cys19-chain 2 cys20, Disulfide chain 2 cys6-cys11)]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Insulin peglispro
Cat. No.:
HY-P4062
Quantity:
MCE Japan Authorized Agent: