Jingzhaotoxin-IX

Cat. No.: HY-P5771: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Jingzhaotoxin-IX Chemical Structure

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Sodium Channel Isoform Specific Products:

View All Isoforms

Na_v1.1 Na_v1.2 Na_v1.3 Na_v1.4 Na_v1.5 Na_v1.6 Na_v1.7 Na_v1.8

Biological Activity
Purity & Documentation
References
Customer Review

Description	Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3^[1].
Molecular Weight	3953.51
Formula	C₁₇₁H₂₅₁N₄₉O₄₈S₆
Sequence	Glu-Cys-Thr-Lys-Leu-Leu-Gly-Gly-Cys-Thr-Lys-Asp-Ser-Glu-Cys-Cys-Pro-His-Leu-Gly-Cys-Arg-Lys-Lys-Trp-Pro-Tyr-His-Cys-Gly-Trp-Asp-Gly-Thr-Phe-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys29)
Sequence Shortening	ECTKLLGGCTKDSECCPHLGCRKKWPYHCGWDGTF-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys29)
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (259 KB) Handling Instructions (2659 KB)
References	[1]. Meichun Deng, et al. Jingzhaotoxin-IX, a novel gating modifier of both sodium and potassium channels from Chinese tarantula Chilobrachys jingzhao. Neuropharmacology. 2009 Aug;57(2):77-87. [Content Brief]