LL-37, human

Name: LL-37, human
Brand: MedChemExpress
SKU: HY-P1222
Rating: 5.0 (2 reviews)

Cat. No.: HY-P1222 Purity: 99.60%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

LL-37, human Chemical Structure

CAS No. : 154947-66-7

Size	Price	Stock	Quantity
1 mg	USD 125	In-stock	Estimated Time of Arrival: December 31
5 mg	USD 260	In-stock	Estimated Time of Arrival: December 31
10 mg		Get quote
50 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 2 publication(s) in Google Scholar

Other Forms of LL-37, human:

LL-37, human TFA Get quote
LL-37, human acetate Get quote

2 Publications Citing Use of MCE LL-37, human

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

Cellular Effect

Cell Line	Type	Value	Description	References
MRC5	IC₅₀	64 μM Compound: LL-37	Cytotoxicity against human MRC5 cells assessed as cell growth inhibition measured after 4 hrs by MTT assay Cytotoxicity against human MRC5 cells assessed as cell growth inhibition measured after 4 hrs by MTT assay	[PMID: 34342438]

In Vitro

LL-37, human (1-20 μg/mL; 24 h) affects HCECs migration^[2].
LL-37, human (0.0001-5 μg/mL;6-24 h) affects cytokine secretion in HCECs^[2].
LL-37, human (1-100 μg/mL; 24 h) shows dose-dependently cytotoxic to HCECs at concentrations over 10 μg /mL^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Migration Assay ^[2]

Cell Line:	Human corneal epithelial cell (HCEC)
Concentration:	1, 2.5, 5, 10 and 20 μg/mL
Incubation Time:	24 hours
Result:	Dose-dependently stimulated HCEC migration but showed no effect on cell proliferation.

Cell Viability Assay^[2]

Cell Line:	Human corneal epithelial cell (HCEC)
Concentration:	0.0001, 0.001, 0.01, 0.1, 0.5, 1, and 5 μg/mL
Incubation Time:	6 and 24 hours
Result:	Dose-dependently increased IL-8, IL-6, IL-1β and TNF-α secretion at 6 and 24 hours in HCEC.

In Vivo

LL-37, human (0.4-2.0 mg/kg; intratracheal injection once) ameliorates MRSA-induced pneumonia of mice^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	6-8 week-old C57BL/6 mice with MRSA-induced pneumonia^[3]
Dosage:	0.4, 0.8, 1.2, 1.6 and 2.0 mg/kg
Administration:	Intratracheal injection; 0.4-2.0 mg/kg once
Result:	Decreased IL-6 and TNF-α release to attenuated MRSA-induced pneumonia of testing mice.

Molecular Weight

4493.26

Formula

C₂₀₅H₃₄₀N₆₀O₅₃

CAS No.

154947-66-7

Appearance

Solid

Color

White to off-white

Sequence

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

Sequence Shortening

[LL-37, 37 aa]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility

In Vitro:

H₂O : 50 mg/mL (11.13 mM; Need ultrasonic)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2226 mL	1.1128 mL	2.2256 mL
5 mM	0.0445 mL	0.2226 mL	0.4451 mL
10 mM	0.0223 mL	0.1113 mL	0.2226 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 99.60%

Select Batch:

Data Sheet (272 KB) SDS (252 KB)

COA (242 KB) RP-HPLC (110 KB) MS (201 KB) Elemental Analysis Report (99 KB)

Handling Instructions (2659 KB)

References

[1]. Dürr UH, et al. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim Biophys Acta. 2006 Sep;1758(9):1408-25. [Content Brief]

[2]. Huang LC, et al. Multifunctional roles of human cathelicidin (LL-37) at the ocular surface. Invest Ophthalmol Vis Sci. 2006 Jun;47(6):2369-80. [Content Brief]

[3]. Hou M, et al. Antimicrobial peptide LL-37 and IDR-1 ameliorate MRSA pneumonia in vivo. Cell Physiol Biochem. 2013;32(3):614-23. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

H₂O	1 mM	0.2226 mL	1.1128 mL	2.2256 mL	5.5639 mL
	5 mM	0.0445 mL	0.2226 mL	0.4451 mL	1.1128 mL
	10 mM	0.0223 mL	0.1113 mL	0.2226 mL	0.5564 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

LL-37, human Related Classifications

Infection

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

LL-37, human154947-66-7Bacterial37-residuecathelicidin-derivedpeptidebroad spectrumcorneaHCECintratracheal injectionInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Email Address *

Phone Number

Department *

Organization Name *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

LL-37, human

Customer Review

Other Forms of LL-37, human:

LL-37, human Related Antibodies

2 Publications Citing Use of MCE LL-37, human

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity

Purity & Documentation

References

Customer Review

LL-37, human Related Antibodies

Molarity Calculator

Dilution Calculator

Complete Stock Solution Preparation Table

LL-37, human Related Classifications

Keywords:

Your Recently Viewed Products:

Customer Review

Request for HNMR Report

SAFETY DATA SHEET (SDS)

Request for HNMR Report