1. Anti-infection
  2. Dengue virus
  3. MLH40

MLH40 is a peptide inhibitor with activity against Dengue virus (DENV) infection, which is found in the conserved ectodomain region of DENV membrane protein. MLH40 inhibits DENV through its N-terminal loop interaction with DENV envelope protein and altering the dimer conformation.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

MLH40 Chemical Structure

MLH40 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

MLH40 is a peptide inhibitor with activity against Dengue virus (DENV) infection, which is found in the conserved ectodomain region of DENV membrane protein. MLH40 inhibits DENV through its N-terminal loop interaction with DENV envelope protein and altering the dimer conformation[1].

Molecular Weight

4684.32

Formula

C209H325N61O58S2

Sequence

Ser-Val-Ala-Leu-Val-Pro-His-Val-Gly-Met-Gly-Leu-Glu-Thr-Arg-Thr-Glu-Thr-Trp-Met-Ser-Ser-Glu-Gly-Ala-Trp-Lys-His-Val-Gln-Arg-Ile-Glu-Thr-Trp-Ile-Leu-Arg-His-Pro-Gly

Sequence Shortening

SVALVPHVGMGLETRTETWMSSEGAWKHVQRIETWILRHPG

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MLH40
Cat. No.:
HY-P10829
Quantity:
MCE Japan Authorized Agent: