1. Peptides
  2. Peptide and Derivatives
  3. Peptides for Drug Delivery
  4. Self-assembling Peptides
  5. Myr5A peptide

Myr5A peptide is an acylated peptide composed of apolipoprotein A1 (ApoA1) analog peptide 5A peptide coupled to the saturated fatty acid myristate. Myr5A peptide self-assembled into lipid nanostructures can be used to encapsulate anthracycline Doxorubicin (HY-15142A) and Valrubicin (HY-13772) for compound release studies in vitro.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Myr5A peptide Chemical Structure

Myr5A peptide Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Myr5A peptide is an acylated peptide composed of apolipoprotein A1 (ApoA1) analog peptide 5A peptide coupled to the saturated fatty acid myristate. Myr5A peptide self-assembled into lipid nanostructures can be used to encapsulate anthracycline Doxorubicin (HY-15142A) and Valrubicin (HY-13772) for compound release studies in vitro[1].

Molecular Weight

4428.09

Formula

C211H321N47O57

Sequence

{Myr}-Asp-Trp-Leu-Lys-Ala-Phe-Tyr-Asp-Lys-Val-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Phe-Pro-Asp-

Sequence Shortening

{Myr}-DWLKAFYDKVAEKLKEAFPDWAKAAYDKAAEKAKEAA

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Myr5A peptide
Cat. No.:
HY-P10453
Quantity:
MCE Japan Authorized Agent: