Nagrestipen

Cat. No.: HY-P3627: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis.

For research use only. We do not sell to patients.

Nagrestipen Chemical Structure

CAS No. : 166089-33-4

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vivo

Nagrestipen (ECI 301) (i.v; 2 μg; daily for 5 days) significantly inhibits tumor growth at 6 Gy local irradiation of tumor sites and enhances the distant septal effect of radiation in male BALB/c mice^[1].
Nagrestipen (ECI 301) (i.v; 0.08, 0.4, 2 μg; day 1,8,15) can inhibit tumor growth in a dose-dependent manner at both irradiated and unirradiated sites of female C57BL/6 with LLC cells^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Male BALB/c mice with Colon26 cells and MethA cells^[1]
Dosage:	2 μg
Administration:	Intravenous injection; daily for 5 days
Result:	Significantly inhibited tumor size without significant toxicity. Stopped tumor growth in the colon not only at the irradiated site but also at the unirradiated.

Molecular Weight

7668.48

Formula

C₃₃₈H₅₁₆N₈₈O₁₀₈S₄

CAS No.

166089-33-4

Sequence Shortening

SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA (Disulfide bridge:Cys10-Cys34;Cys11-Cys50)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Handling Instructions (2659 KB)

References

[1]. Kenshiro Shiraishi, et al. Enhancement of antitumor radiation efficacy and consistent induction of the abscopal effect in mice by ECI301, an active variant of macrophage inflammatory protein-1alpha. Clin Cancer Res. 2008 Feb 15;14(4):1159-66. [Content Brief]

Nagrestipen Related Classifications

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Nagrestipen166089-33-4OthersECI 301MIP-1αantitumorradiation oncologytumor metastasisInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks